Conserved Protein Domain Family
cyd_oper_ybgE

?
TIGR02112: cyd_oper_ybgE 
cyd operon protein YbgE
This model describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131167
View PSSM: TIGR02112
Aligned: 6 rows
Threshold Bit Score: 100.122
Threshold Setting Gi: 33149013
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28806042    8 VAKFHEPMDKTLLRVLSLILGFMHVGLVMWDPEAYHQAIGGFNAVIAPALIWALCSSMVFGVGFKPRNWYWQLLFSPYFS 87
gi 2506622     5 IATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSELEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLA 84
gi 33149013    2 IHSIYNLTRKGWLKALSFILALLLFIVILLNPQVFASYFGGHVPYLAIFVFYGMAILWIHGIGLDIHRTFWQLLFLPIMG 81
gi 447209361  12 IARCHDITDKALLKALSILLGFYNAAMVMWDPNSYADRIGGFNAVIAPLMIWAICASMVFGVGFRPRHWVWQIVFSPYLS 91
gi 488156828  18 SDKLYELMDKGPLRALSLVLAFALAFCVFWDPTRFAAATSSLEVWQEVFIVWAVCTGVIHGVGFRPKQVWLRAFFAPLPA 97
gi 492013428   2 INSLYQIFNKGSLRTLSFIFAILITLFFFFNINDFSTNLRSAPAPLILLMIWGTGILWIHGIGFEIRSTLWKGLFSPIIG 81
                         90
                 ....*....|...
gi 28806042   88 LAILIYLTALYFM 100
gi 2506622    85 DIVLIVGLIFFFF 97
gi 33149013   82 YLIVISTLIFLIL 94
gi 447209361  92 LTILSYLTLVQLI 104
gi 488156828  98 IVILATGLFYFFA 110
gi 492013428  82 YIGFILAIVVSWA 94
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap