Conserved Protein Domain Family
coaC_strep

?
TIGR02113: coaC_strep 
phosphopantothenoylcysteine decarboxylase, streptococcal
In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis (see TIGR00521). These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This model describes proteins from the genera Streptococcus and Enterococcus homologous to the N-terminal region of TIGR00521, corresponding to phosphopantothenoylcysteine decarboxylase activity. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A]
Statistics
?
PSSM-Id: 131168
View PSSM: TIGR02113
Aligned: 6 rows
Threshold Bit Score: 311.361
Threshold Setting Gi: 15672554
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006957    3 KKILLAVSGSIAAYKAADLSHQLTKLGYHVNVLMTNAAKQFIPPLTLQVLSKNPVYSNVMKEDDPQVINHIALAKQADLF 82
gi 446518468   3 KRITLAVTGSISAYKAADLTSQLTKIGYDVHIIMTQAATEFITPLTLQVLSKNPIHLDVMDEHNPKIINHIELAKRTDLF 82
gi 499224807   3 KHITLAVSGSISAYKAADLTSQLTKIGYDVHIIMTQAATQFITPLTLQVLSKNAIHLDVMDEHDPKVINHIELAKRTDLF 82
gi 559552723   7 KTILLGVSGSISAYKAADITSQLAKLGYNVEILMTKSSTAFITPLTLQSLSKNPVHTDVMMEIDPSKINHIELAKKADLF 86
gi 447206872   2 ANILLAVTGSIASYKSADLVSSLKKQGHQVTVLMTQAATEFIQPLTLQVLSQNPVHLDVMKEPYPDQVNHIELGKKADLF 81
gi 489222076   2 TKITLAVTGSIAAYKAADLTSLLTKEGHDVTVLMTKSATQFITPLTLQVLSKNKVHLDIMDEERPELVNHIDLAKNTELF 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006957   83 LLAPASANTLAHLAHGFADNIVTSVALALPLEVPKFFAPAMNTKMYENPITQSNIALLKKFGYKEIQPKSSVLACGDVGS 162
gi 446518468  83 IVAPASANTIAHLAYGFADNIVTSVALAMPDETPKLIAPAMNTKMYHNTITQRNIDILKKIGYQEIEPRISLLACGDTGQ 162
gi 499224807  83 IVAPASANTIAHLAYGFADNLVTSVALALPATTPKLIAPAMNTKMYQNPITQENIKRLSTIGFTEIPPKSSLLACGDKGP 162
gi 559552723  87 LVAPASANTIGKLAHGIADDLLSTVALALYPETPKIIAPAMNTYMYQNPIVQRNIGILKEVGYQEIIPREALLACGDYGR 166
gi 447206872  82 IVVPATANTIAKLAHGFADNMVTSTALALPSHIPKLIAPAMNTKMYDHPVTQNNLKTLETYGYQLIAPKESLLACGDHGR 161
gi 489222076  82 LVAPATADTISRLAQGRADDIVTSVALALEPSVPKYFAPAMNTKMYQHPLTQKNIEILKKIDYNMIQPKKSLLACGDFGE 161
                        170
                 ....*....|....*..
gi 26006957  163 GALADLDTIIQKIEEQL 179
gi 446518468 163 GALADISTILKCIQEVA 179
gi 499224807 163 GALADIDVILATIDTIW 179
gi 559552723 167 GALATVEDILQTVMKIL 183
gi 447206872 162 GALADLTIILERIKETI 178
gi 489222076 162 GALADLPDILSDLKNSL 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap