2GK4


Conserved Protein Domain Family
coaB_strep

?
TIGR02114: coaB_strep 
Click on image for an interactive view with Cn3D
phosphopantothenate--cysteine ligase, streptococcal
In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis (see TIGR00521). These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This model describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of TIGR00521, corresponding to phosphopantothenate--cysteine ligase activity. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A]
Statistics
?
PSSM-Id: 131169
View PSSM: TIGR02114
Aligned: 5 rows
Threshold Bit Score: 339.867
Threshold Setting Gi: 29377139
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GK4_A         5 KILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEXQERVQD 84
gi 499224806   2 KLIITSGGTTEPIDAVRGITNHSTGQLGKLITERFLQYHHDVTLVTTKTATKPLPNKRLRIIEVETVNDLMAALKDQVPH 81
gi 446204713   7 KILITSGGTTEKIDTVRSITNHATGTLGKIIAEKYLREGHQVTLVTTKNAVKPESATNLSTFEIEDVDSLIKTLKPLVKE 86
gi 446622155   2 KILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEMQERVQD 81
gi 488310346   2 DVLVTAGGTSEPIDNVRSITNHSSGGLGKAIAESFLAAGHTVTYVTTKHALRPTQQLDLSIKEIETTVELATTLEQLFAE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GK4_A        85 --YQVLIHSXAVSDYTPVYXTGLEEVQAS----------------------SNLKEFLSKQNHQAKISSTDEVQVLFLKK 140
gi 499224806  82 --HDILIHSMAVSDYTPVYMTDLEQVSQA----------------------DNLNCFLCEHNSEPKISSASDYQVLFLKK 137
gi 446204713  87 --HDILIHSMAVSDYTPVYMADFEKVKSS----------------------DHLDTFLRKDNHEGKISSESEYQVLFLKK 142
gi 446622155  82 --YQVLIHSMAVSDYTPVYMTGLEEVQAS----------------------SNLKEFLSKQNHQAKISSTDEVQVLFLKK 137
gi 488310346  82 kqFDAIVHAMAVSDFTTETAQTEEQFIDSfaqqlseqtlpktkealvtivqNTLNQIADIPQTATKISSDTDRLLIFLKK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GK4_A       141 TPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKN-QLQTVQTKEEI 219
gi 499224806 138 TPKVISYVKQWNPNIKLVGFKLLVNVPQEELIKVARASLAKNHADYILANDLVDIQTGMHKALLISNN-EVASADTKEAI 216
gi 446204713 143 TPKVISLVKKWNPQITLVGFKLLVNVTKENLFKVARHSLIKNKATFILANDLIDITSKHHIAYLLDHD-NVYKATTKEDI 221
gi 446622155 138 TPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKN-QLQTVQTKEEI 216
gi 488310346 162 NPKVIQMIRDKQPQTVLVGFKLLVNVSQEELVQVAQAALVKNRCDFVLANDLMNVHETEHKGLLINETgIVQEAYSKQGI 241
                        250
                 ....*....|..
2GK4_A       220 AELLLEKIQAYH 231
gi 499224806 217 ADLLYERMTKHD 228
gi 446204713 222 AQLIYEKVKKYD 233
gi 446622155 217 AELLLEKIQAYH 228
gi 488310346 242 GSMIVKNVEKKW 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap