Conserved Protein Domain Family
panF

?
TIGR02119: panF 
sodium/pantothenate symporter
Pantothenate (vitamin B5) is a precursor of coenzyme A and is made from aspartate and 2-oxoisovalerate in most bacteria with completed genome sequences. However, some pathogens must import pantothenate. This model describes PanF, a sodium/pantothenate symporter, from a larger family of Sodium/substrate symporters (pfam00474). Several species that have this transporter appear to lack all enzymes of pantothenate biosynthesis, namely Haemophilus influenzae, Pasteurella multocida, Fusobacterium nucleatum, and Borrelia burgdorferi. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 131174
View PSSM: TIGR02119
Aligned: 5 rows
Threshold Bit Score: 656.416
Threshold Setting Gi: 19704020
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29897210    3 WYVIIPMIISFIVEFLIGVYASKRVQATAhnkFLQEYFLGGRELGGLLLAMTMIATYGSASSFIGGPGIAYNMGLGWVLL 82
gi 1172009     3 LGIILPLIIYLTFVFGAAIFAYVKRTKGD---FLTEYYVGNRSMTGFVLAMTTASTYASASSFVGGPGAAYKYGLGWVLL 79
gi 488138857   3 TDVVLPLVGYLVLVFGLSIYAYTRRQTGN---FLNEYFIGNRSMGGFVLAMTLTATYISASSFIGGPGAAYKYGLGWVLL 79
gi 499377327   3 WEAVIPLFLLIFIIFLVGMWSSKFVRNTDs--FVQEYFLGGRSLGGFILAMTLVTTYGSASSFLSGPGTAYNEGLGWVLL 80
gi 492609380   4 iliiipiiiYLVTMLLIAYKVNNIKNSSKs--FTNEYYLGSRSMGGFVLAMTIVATYVGASSFIGGPGIAYNLGLGWVLL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29897210   83 SAIQVVTGYIVLTVIGKKFAIIARKMEAITLIDYLKGRYNNKAVVILSALCIIIFLFSATVAQWVGGGRLIESLTGLSYT 162
gi 1172009    80 AMIQVPVVWLALGALGKKFALLSRETNALTINDLFFYRYKNKYLVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYT 159
gi 488138857  80 AMIQLPAVWLSLGVLGKKFAILARRYNAVTLNDMLYARYQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYD 159
gi 499377327  81 SMTQLATGYFVLMVLGKRFAIVTRKYKAVTIVDFLKERYQSKWVVLLSSFSILIFLFSAMSAQWIGGGRLIQSLTGMSYL 160
gi 492609380  82 ACIQVPTAFFTLGVLGKKLSIISRKLNAITIFDVLKARYNNSFLNVLASIMLIVFFISAIVAQFIGGARLFEAVTGLSYL 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29897210  163 TALFLFTFSVLVYVLIGGFRAVALSDTLLGIIMLVGTTIILIATVIAGGGIEKIMQELVQINPKLITPFGADGSLTKSYV 242
gi 1172009   160 QALLLFALTVGIYTFIGGFRAVVLTDTIQGTVMIFGTIILLIGTIYALGGVESAVNKLTEIDPDLVTPYGPNGMLDFQFM 239
gi 488138857 160 TGLLIFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQHIDPALVSPQGGDQILDVPFM 239
gi 499377327 161 SALFIFSAAVLIYVIVGGFRAVAITDGIQGIIMFLGTLILLIAVIVAGGGVPQIMEDLRAENMNLITPFGADGGLTPAFV 240
gi 492609380 162 TGLIIFSSVVIIYTTFGGFRAVTLTDAIQAVVMFTATTVLFVVILKNGNGMENIMMKIKDIDPNLLRPDSGGN-IAKPFI 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29897210  243 TSFWILIGIGVVGLPQISVRAMSYKNSKAMHQALIIGTVVVGTIMIGMHLTGVFARVVLPGITVPDKVMPLLAMEVLPPW 322
gi 1172009   240 ASFWILVCFGVVGLPHTAVRCMAFKDSKALHRGMLIGTIVLSIIMLGMHLAGALGRAVIPNLTVSDQVIPTLMIKVLPPI 319
gi 488138857 240 ASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIVVAILMFGMHLAGALGRAVLPDLKIPDQVIPTLMITVLPPF 319
gi 499377327 241 SSFWILVGVGVIALPQIAVRAMSYKNSRSLHRAIIISTIVVGFIMLNMHLIGVLGRPVMPGIEVGDTVMPLLAQEVLPGW 320
gi 492609380 241 MSFWILVGIGILGLPATTIRCMAFKDTKAMHNAMIIGTSLVGILVLGMHLVGVMGRAVIPDLQEVDKIIPILALKNLYPI 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29897210  323 LAGVFLAAPMAAIMSTVNSLLLLVSSSIIKDIYVNYINKDAA-DSTIKKGSLWITGIVGLLVYAAAIKPPDFLIWLNLFS 401
gi 1172009   320 VAGIFLAAPMSAIMSTIDAQLIQSSSIFVKDLYLSAKPEAAKnEKKVSYFSSIITLILTALLIFAALNPPDMIIWLNLFA 399
gi 488138857 320 AAGIFLAAPMAAIMSTINAQLLQSSATIVKDLYLNLWPAELKnERKLARISSLSTLILGLLLLLAAWRPPEMIIWLNLLA 399
gi 499377327 321 LAGIVLAAPMAAIMTTVNSLLLMVSSTIIKDVYLNYIEKEAT-DKKVRGLSMGVTALIGVIVIVMSLQPPDLIIWLNLFS 399
gi 492609380 321 LAGVFIGGPLAAAMSTVDSLLIISSSTLIKDLYVTYLDKNTS-ESKIKKISMCTSFLIGILVFILSIKPISLIAWVNLFA 399
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 29897210  402 FGGLEAAFIWPIVLGLYWRKGNATGALASILVGVGSYMCIHLFYPNPFGIHTVVFPICFAFIAYVIGSMSAVKK 475
gi 1172009   400 FGGLEAAFLWVIVLGIYWDKANAYGALSSMIIGLGSYILLTQLGIKLFNFHQIVPSLVFGLIAFLVGNKLGERR 473
gi 488138857 400 FGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSLTLNLLAFYIGNLFGDRA 473
gi 499377327 400 MGGLEAAFIWPIVLGLYWNRGNKYGAIASMITGVSSYIIFESFFPQPFGMHSVVTSITIALIAYIIGSLSKQHP 473
gi 492609380 400 LGGQEIVFFCPLILGLYWKGANATGAIASIFAGIATYLTLEILKTKIFALHNIVPGLVVAIIVFIVASYFGKKS 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap