Conserved Protein Domain Family
phaP_Bmeg

?
TIGR02131: phaP_Bmeg 
polyhydroxyalkanoic acid inclusion protein PhaP
This model describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium. The role of the protein may include amino acid storage (see McCool,G.J. and Cannon,M.C, 1999).
Statistics
?
PSSM-Id: 131186
View PSSM: TIGR02131
Aligned: 2 rows
Threshold Bit Score: 187.253
Threshold Setting Gi: 29895008
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4160471    1 MSTVKYDtVIDAMWEQWTKGLQNIADGNKQIEQWTLKALEQQQEFVTKAVEQLQATDKQWKAELEDLQQKTVENLRKTAG 80
gi 29895008   1 METKPYE-LVDAFWKNWSQSLSLFSSAGKQLEQLTLETLKQQQDALHKLTSGVDELEKELQQLTAQFNNQYTDYVKQLTG 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4160471   81 NAVADSYEEWTNRTHEALNKLQELFFNQSKSSYSLVKQAQEQYHQVVTQLVEEQKKTRQEFQHVSDAYVEQVKSLQKSFA 160
gi 29895008  80 NSLNDQINEWQDKWKELSAHMHQLTVSPTKTSLSILTQTSGQFEETTKQFIEQQQLQREEAQKQLEGFLEEFKSKQLELA 159

                ....*
gi 4160471  161 QSLEQ 165
gi 29895008 160 KKFEE 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap