Conserved Protein Domain Family
phaR_Bmeg

?
TIGR02132: phaR_Bmeg 
polyhydroxyalkanoic acid synthase, PhaR subunit
This model describes a protein, PhaR, localized to polyhydroxyalkanoic acid (PHA) inclusion granules in Bacillus cereus and related species. PhaR is required for PHA biosynthesis along with PhaC and may be a regulatory subunit.
Statistics
?
PSSM-Id: 131187
View PSSM: TIGR02132
Aligned: 2 rows
Threshold Bit Score: 238.574
Threshold Setting Gi: 27348112
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13812267   1 MEQQKvFDPFQAWKDVYDKTESYWGKVIGDNMNREEFSQLMGNVLNMNLQYQQAVNEVTGRYLHQVNVPTKEDVANVASL 80
gi 27348112   1 MIDQK-FDPLQAWKNAYEQTETFWGKALNETIKTEEYSAWMGSVLDLNLFYQKALNDTTKNYLEQVNVPTKEDIARVATL 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13812267  81 VINVEEKVELLEEQFDDRFDELEaqqeSASALKKDVTKLKSDVKSLDKKLDKVLSLLEgqqktqdelketiqkqiktqge 160
gi 27348112  80 VINLENKVDNIEEFLEDKVESVG----QAPTLKRDVTKVKQDIRTLETKVDQILELLE---------------------- 133
                       170       180
                ....*....|....*....|....*....
gi 13812267 161 qlqaqlleKQEKLAEKPKAEAKSEAKPSN 189
gi 27348112 134 --------KQNAVLAKLQEPVKEEVKPTN 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap