Conserved Protein Domain Family
permease_CysT

?
TIGR02139: permease_CysT 
sulfate ABC transporter, permease protein CysT
This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 131194
View PSSM: TIGR02139
Aligned: 12 rows
Threshold Bit Score: 331.597
Threshold Setting Gi: 15640561
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878457    3 YFSKLSCSWRITLGYLLFMLILPILALLSRASQELFSNFWSIAMEPAAIYAYSITLSMALIASIVNGIFGIFIAWILVRY 82
gi 126795     22 FLTKFELVLACALHYGTFILALPIFFLLYKTKQQPWNILLQTALEPVVLSAYGFTFLTALLATIINAIFGLILAWVLVRY 101
gi 499201732  12 ILPGFGLSLGFTMMYLGILVLLPLSMVFINTSSMGWQAFWQAITEPRVLASYRLSFGAAIIAASINAVFGLLIAWVLVRY 91
gi 493158105  19 VIPGFGLTFGFSVAYLTLIILIPLAALVLRSSDVGLAGFWRIVTDERTLKALETSFGTAFIAALVNVVFGVILAWVLVRY 98
gi 446740712  15 GKTAFGITLGVTVTYLSLIVIIPLGALFLKSTGIGWEGFWKLLTHERILAALYLSFGAGATAAILNLFIGFLFAWVLVRY 94
gi 492150629   8 VIPGFGLTLGYTLVYLSLIVLLPLAAMFIHAAQLTWDQFWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRY 87
gi 499346616  17 VMPGLGLSLGITLTWLGLIVLIPLLGVFIKTSGLGWDGLWRVWSEPRVLSALRVSFGTAFAAGAFNAVMGTWVAWVFVRY 96
gi 325135909  37 VLPGFKLSLGLTVLCLSLLVVLPFAMMAAKAAEIGWGGFWNTIAEPNVLAAVWLSLRMSFYAMLTNVVFGTLVAWVLVRY 116
gi 499303722  22 KVVNLPWTWRITIGYLTVMLFVPIIAMFLKASTEPPARFWEIATSELALATYNVTFVTSLLAALLNGVFGTLIAWVLVRY 101
gi 499386780   9 VLPGFGITLGFSVLYLSLLFLLPVAGLILFTLQMSWADFWVAISHPQVVASYKLSFAASFIGATINAVFGTLVAWVLVRY 88
gi 666383818   5 VLPGLKLSLGVTLTYVAIIVLLPLSALVFKAASLGPAEYWSIISSPRAVASYRVTVLCALAATLFNVVFGVALAWVLTRY 84
gi 446453955  15 VLPGFALSLGVSLLFVSLILLLPATGLIMQTSNMTFSEYWQVIADPRVVASYKVTVGSALIASLFNGLFGLLLAWVLVRY 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878457   83 NFPGKRIVDAAIDLPFALPTSVAGLTLATVYSEKGWIGHFLQSLSIKVVFTKLGVGVAMIFVSFPFVVRTLQPVLQDIEK 162
gi 126795    102 EFPGKKLLDATVDLPFALPTSVGGLTLMTVFNDKGWIKPICSWLNIKIVFNPIGVLLAMIFVSLPFVVRTIQPVLQNMEE 181
gi 499201732  92 HFPGKRIIDGLVDLPFALPTAVAGIALTTLYTTNGWIGQYLEVFGIRIAFTPLGVIVALTFIGLPFVVRMVQPVLQGIEK 171
gi 493158105  99 RFAGRRFVDAIVDIPFALPTAVAGISLAAIYAPNGWIGGLLSPYGIRIAFTRMGIVIALIFIGLPFVVRTVQPIIEEISR 178
gi 446740712  95 NFPGKSLLDSLVDLPFTLPTAVAGIALTTIYTPNGIIGKFFEPFGIKIAYTPIGIVIALVFIGFPFVVRTVQPVLEEFPK 174
gi 492150629  88 TFPGRKIIDAMIDLPFALPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLADIPR 167
gi 499346616  97 RFPGKRLFDALIDLPFALPTAVAGIALTALYGGNGWVGRWLEAIGIKVAYTQLGIVIALVFVGLPFVVRVVQPVLAESER 176
gi 325135909 117 EFPGKGLANALVDLPFALPTAVTGIALATLYAPNGWIGRFFEPLGIKIAFTPVGIWIALVVVSLPFIVRAVQPVLEELSG 196
gi 499303722 102 DFPLKRIIDATVDLPFALPTSVAGLTLATVYSDNGWIGSLLAPLGIKVSFTRLGVWVAMVFISLPFVVRTVQPVLQEMEH 181
gi 499386780  89 QFLGKKVVDALVDLPFALPTAVAGIALVTLYSTTGWVGQYLYLWGIKVAYSEIGVVIALTYIGLPFVVRTVQPVLADFSK 168
gi 666383818  85 RFPGWRIVDAIVDLPFALPTAVAGIALTTLFAGNGWFGSLLAPLGIKVAYTPVGIMVAMAFTSLPFIVRTVQPVLEDLDP 164
gi 446453955  95 TFPGKRILDALVDLPFALPTAVAGITLATLYSANGWIGSVLAELGIKVAYTPLGIIVAMAFTSIPFVVRTVQPVLEEISR 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878457  163 ELEEAAWSLGASSWTTFWKVIFPSLIPSLLTGIALAFSRAVGEYGSVVIIASNIPFKDLTAPVLIFQKLEQYDYTGATVI 242
gi 126795    182 DLEEAAWCLGASPWTTFWHILFPPLTPSLLTGTTLGFSRALGEYGSIVLIASNIPMKDLVISVLLFQKLEQYDYKSATII 261
gi 499201732 172 ELEEASACLGANRLQTFSKIIFPTVLPALLTGFALAFARALGEYGSVVFISGNLPMQTEITPLLIMTKLEQFDYAGATAL 251
gi 493158105 179 EVEEAAATLGASRFQTIWRVLLPGLQPAIITGFALAFARGIGEYGSVIFIAGNTPYKSEIAPLLIVIKLEEYDYAGATAL 258
gi 446740712 175 ELEESAYCLGANRWQIFRRVIFPELVSPLVTGAAMAFARGIGEYGSVVFISGNLPGKTEILPLLIVTKLEQYEYEEATGI 254
gi 492150629 168 EVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMPMKTEILPLLIMVKLDQYDYTGATAI 247
gi 499346616 177 EIEEAAATLGASRWQLVWRVVLPALWPAVLTGFALAFARGVGEYGSVIFIAGNLPNATEIAPLLITIRLEEFDYAGATAI 256
gi 325135909 197 EYEEAAATLGASRWTTFRRVLLPEITPALLTGAGMMFARATGEYGSVIFIAGNIPMVSEILPLIITGKLEQFDVQGASAV 276
gi 499303722 182 DVEEAAWSLGASQWQTFSKVILPPLLPSILTGVALGFSRAVGEYGSTVIIASNTPFQDLIAPVLIFQRLEQYDYSGATVI 261
gi 499386780 169 ELEEASASLGASRFTTIKRVILPAVLPALLTGYALAFARAVGEYGSVIFISGNLPYRTEITPLLIVSKAEQYDYNGAAAI 248
gi 666383818 165 ALEEAAQSLGGSDLEVFRKIILPLLTPALLAGLSLSFARSLGEFGAIIFIAGNQPFSTEITALLIFIRLEEYDYQAAAAI 244
gi 446453955 175 EEEEAGMTLGASDAAVFWKVILPSLKPALLVGTALSFTRSLGEFGAVIFIAGNMPYISEITSLMIFVRLQEFDFPAASAI 254
                        250       260
                 ....*....|....*....|....*
gi 13878457  243 GTVILSISLFILVGINIIQSLNQMY 267
gi 126795    262 ASFVLIISFTALFFINKIQLWKKTF 286
gi 499201732 252 AAVMLIISFFMLLFINILQWWSQRR 276
gi 493158105 259 ATVMLALSFAMLLFINLIQTRIRRK 283
gi 446740712 255 AFIMLVISFSILLCINVIQNIAARK 279
gi 492150629 248 GVMMLVVSFILLLLINLLQRRIETP 272
gi 499346616 257 AAAMLLLSFVILLVVNTLQARLLRY 281
gi 325135909 277 ALFMLLVSFVILFALNVMQWALGRR 301
gi 499303722 262 GVVLLTISLVLLLGINLLQGWARRY 286
gi 499386780 249 GVVMLAAAFILLLIINSLQWWASKR 273
gi 666383818 245 ASVLLITAFVMLAVTNYLQARALRY 269
gi 446453955 255 ASVVLLTSLLLLLMINLWQGAYLRS 279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap