Conserved Protein Domain Family
modC_ABC

?
TIGR02142: modC_ABC 
molybdenum ABC transporter, ATP-binding protein
This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 131197
View PSSM: TIGR02142
Aligned: 6 rows
Threshold Bit Score: 522.75
Threshold Setting Gi: 585499
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67468915    6 IRARFRVDYAGFALDVDLTLPGHGVTALFGHSGSGKTTLLRCVAGLERAAEARLEINGELWQDSAAgvFLPTHRRALGYV 85
gi 585499      2 ISARFSGRQGDFTLDAAFDVPGQGVTALFGPSGCGKTTVLRCMAGLTRLPGGHLVVNGVTWQEGRQ--ITPPHRRAVGYV 79
gi 32172422    2 LELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKgiCLTPEKRRVGYV 81
gi 445927678   4 VILQLQKRLGETQLDVDLRLPAVGICAIFGRSGAGKTSLINLISGLTTPDVGEIHLAGRTLFSSSQgiQLPIEQRKIGYV 83
gi 499275010   3 LSVSARHRLGTFELDASFTSEG-GVTALFGRSGSGKTSMIRIIAGLLRPDEGQISLDGEVLADSGKrlFLPAHKRRFGYV 81
gi 499234599   3 LCIDIEKRLGDFSLKLKTEISG-ERVGIFGASGSGKSTLVHLIAGLIKPYAGEIYLDDTCLFSSRKkiDLSPEKRRISIV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67468915   86 FQEASLFPHLSVRRNLEYGMKRVDAASRqVSWERVLELLGIGHLLERLPGRLSGGERQRVGIARALLTSPRLLLMDEPLA 165
gi 585499     80 FQEASLFTHLSVRENLVYGLRRARGPLR-ISEAEVTQLLGIDPLLRRPTATLSGGERQRVAIGRALLSQPELLLMDEPLS 158
gi 32172422   82 FQDARLFPHYKVRGNLRYGMSKSMVDQ----FDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLA 157
gi 445927678  84 FQDARLFPHYTVRGNLNYGVTDADPEY----FASVTRLLALEPLLVRYPRDLSGGEKQRVAIGRALLSKPDLLLMDEPLA 159
gi 499275010  82 FQEARLFPHLSVAQNLRYGRWFTTGKDTnANDDRIIDMLGISHLLQRRPNRLSGGEKQRVAIGRALLSSPRLLLMDEPLA 161
gi 499234599  82 FQQATLFPHLGVKSNLLYGYKRCRPSERrIRPEAIIEVLNLGHLVGRGVGKLSGGEKQRVALGRAVLANPRLLVMDEPLS 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67468915  166 ALDLKRKNEILPYLERLHDELDIPMLFVSHLPDEVARLADHVVLLDQGRVTAQGSLQDIMARLDL-P-TAFHEDAGVVIE 243
gi 585499    159 ALDRISRDEILPYLERLHASLQMPVILVSHDLSEVERLADTLVLMEAGRVRAAGPIAAMQADPNL-P-LIHRPDLAAVIE 236
gi 32172422  158 SLDIPRKRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM-NpWLPKEQQSSILK 236
gi 445927678 160 SLDMPRKKEVMPFLENLAQHFRLPILYVSHSMQEILRLADHLVVLEQGKVLSAGPIEQVWSSKAMrP-WQSFSEQSTLFS 238
gi 499275010 162 SLDEQRKAEIIPYLERLRDETKIPIVYVSHSIQEVARLADRVVVMKDGKVEAEGKAAEVLSRPDF-StYLERREAGSILS 240
gi 499234599 162 ALDDSLRYQIIPYLRSVSAEFGIPCLFISHSLTEMQLMTERVLVVRDGRLAGISTPDELARTG------MATNPRGYLNL 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67468915  244 SVVAEHDDHYHLTRLAFP-GGAVLVARRPEAPGQRLRLRVHARDVSLANSRIEDSSITNVLPATVREVVEAD---TpAHV 319
gi 585499    237 GVVIALDPAYGLSTLQVP-GGRIVVPGNLGPIGARRRLRVPATDVSLGRHAPTDTTILNALPAVILGAEAAEgyqItVRL 315
gi 32172422  237 VTVLEHHPHYAMTALALG-DQHLWVNKLDEPLQAALRIRIQASDVSLVLQPPQQTSIRNVLRAKVVNSYDDN-----GQV 310
gi 445927678 239 ATVAKHHQTYGLTQVRLAeDVWLWVQQVEADVGSSVRMQVRANDVSIALDKPTASSIRNILPARIVAIEHQQp-sK-KSV 316
gi 499275010 241 GNIESFDERHGLAAVRLN-AALLQVPAKKATAGTPARVLIPARDVMLALVKPEGLSALNILEGHVTGISESE---D-GMV 315
gi 499234599 236 LRLDGATQKDGLFHYPWG-NGHLIISE--GRTGEESLFELSSRDIILFKQHPEAISARNLLECRVAELFDSD-----GRK 307
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 67468915  320 LVRLEAE-GTPLIARITRRSCDQLGIAPGRRMWAQIKAVALL 360
gi 585499    316 ALGASGE-GASLLARVSRKSFDLLGFQPGEQVVARLKAMALS 356
gi 32172422  311 EVELEVG-GKTLWARISPWARDELAIKPGLWLYAQIKSVSIT 351
gi 445927678 317 SLKLELApHCYLWAVVTEWAHAELALEVGMPVFAQIKGVSVA 358
gi 499275010 316 TIQMDCG-GDIIQSRITDLSRERLHLEPGKPVHAIIKSAALD 356
gi 499234599 308 GVVLESG-GKTLVAEIVRSAAEELGIAPGTMLFAAIKASAFR 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap