Conserved Protein Domain Family
PhoB

?
TIGR02154: PhoB 
phosphate regulon transcriptional regulatory protein PhoB
PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]
Statistics
?
PSSM-Id: 131209
View PSSM: TIGR02154
Aligned: 10 rows
Threshold Bit Score: 383.603
Threshold Setting Gi: 27349347
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30139172    1 MSATVLVVEDESAIQELIAYNLRNAGYTAVCTNSAEQAAAMVNEVlPDLVLLDWMLPGKSGIELARSLRRDPRTKPIPVI 80
gi 1172480     1 MTRKILIVEDECAIREMIALFLSQKYYDVIEASDFKTAINKIKEN-PKLILLDWMLPGRSGIQFIQYIKKQESYAAIPII 79
gi 531494      1 MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPwPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVV 80
gi 33577567    1 MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAElPDLILLDWMLPGASGLSLARKLRDEERTRAVPVI 80
gi 6531667     1 MTPYVLVVEDEDALATLLHYNLDKEGYRVGVAGDGEEALIMANERgPDLVILDWMLPKVSGIEVCRRLRGRAETRNVPII 80
gi 4768853     2 AALRLLLVEDDDALAELLKWHFSKQNFEVVHTRDGDEALLLARENpPDIMLLDWMVEGTSGIEVCRQLRRYPETANLPII 81
gi 27349347    1 MGARIMVVEDEEALTELLRYNLEGDGYDVETVMRGDDADTRLKEHiPDLIVLDWMLPGLSGIELCRRLRTRPETKQLPII 80
gi 21388712    5 DQPVVLLVEDEPAQREVLSYNLESEGFRVVQAGNGDEALMLVEEAgPDVIVLDWMLPSVSGIEVCRQLKSRPSTRSVPII 84
gi 499258272  15 VGRNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRkPDLILLDWMLPGTSGIELARRLKRDELTGDIPII 94
gi 489579307   1 MQKRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREAQTAIADRvPDLILLDWMLPGTSGLDLARRWRKEQLTREIPII 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30139172   81 MLTARVDERDKVIGLETGADDYVTKPFSPRELIARIKAVLRRSLPEASDeILDIGGVQINPMTHRVTVTDLNdgthekeL 160
gi 1172480    80 MLTAKSTEEDCIACLNAGADDYITKPFSPQILLARIEAVWRRIYEQQSQ-FIQIDELSIDENAQRVFFQQQE-------I 151
gi 531494     81 MLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVEeVIKMQGLSLDPTSHRVMAGEEP-------L 153
gi 33577567   81 MLTAKGAEQDKVDGLEAGADDYITKPFSPKELMARIKAVLRRRAPQLTDdIIDVAGLKLDPVTHRLSGHSQS-------L 153
gi 6531667    81 MLTARGEETDRIRGLDTGADDYVVKPFSMVELTARVRAVLRRIRPGLADdRITVGDIIIDRVAHRVKRSGKE-------I 153
gi 4768853    82 MLTARGEEDDRIRGLETGADDYVTKPFSPRELVARVLAVLRRIRPALSKeQLNYNDIEMDLVSHRVKRAGTN-------V 154
gi 27349347   81 MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLAtVLAYGDIELDRDKRRVARSGRP-------I 153
gi 21388712   85 MLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRARPSSVGlTLEFEDIRLDPETHKVHRGGQL-------L 157
gi 499258272  95 MLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRRTGPSDSEaPIEVGGLLLDPISHRVTIDGKP-------A 167
gi 489579307  81 MLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMRRTREDDEDgSVAVGKLRIDGAAHRVFAGDAP-------V 153
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 30139172  161 LLSPTEYRLLYFLMAHAERVHTRAQLLDRVWGDHVFVEDRTVDVHIRRLRKALDVAGKADLVQTVRGAGYRFS 233
gi 1172480   152 NLSSTEFKLLHFFMRHPEKVYSREQLLNRIWHNDLEVEYRTVDSYIRRLRRNLAPFQCEHYIQTVRGSGYRFS 224
gi 531494    154 EMGPTEFKLLHFFMTHPELVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFS 226
gi 33577567  154 SIGPTEFRLLHFFMTHPERVFSRSQLLDQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSGYRFT 226
gi 6531667   154 HLGPTEFRLLDYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKELNGTTDADPIRTVRSAGYSLD 226
gi 4768853   155 SIGPTEFRLLRHLMEYPRRVFSREKLLDYIWGQDSDIELRTVDVHIRRLRKALNRDGLPDLIRTVRSAGYALD 227
gi 27349347  154 DLGPTEYRLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNLGREQDPIRTVRGAGYALD 226
gi 21388712  158 KLGPTEFRLLSTFMEKPGRVWSREQLLDRVWGRDIYVDSRTVDVHVGRLRKALCLHGGEDPVRTVRGAGYALG 230
gi 499258272 168 EMGPTEYRLLQFFMTHQERAYTRGQLLDQVWGGNVYVEERTVDVHIRRLRKALG-EAYENLVQTVRGTGYRFS 239
gi 489579307 154 PIGPTEYRLLHFFMTHPERVYTRTQLLDHVWGGSVYVEERTIDVHIRRLRKTLEPFGLENMVQTVRGSGYRFS 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap