Conserved Protein Domain Family
PA_CoA_ligase

?
TIGR02155: PA_CoA_ligase 
phenylacetate-CoA ligase
Phenylacetate-CoA ligase (PA-CoA ligase) catalyzes the first step in aromatic catabolism of phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Often located in a conserved gene cluster with enzymes involved in phenylacetic acid activation (paaG/H/I/J), phenylacetate-CoA ligase has been found among the proteobacteria as well as in gram positive prokaryotes. In the B-subclass proteobacterium Azoarcus evansii, phenylacetate-CoA ligase has been shown to be induced under aerobic and anaerobic growth conditions. It remains unclear however, whether this induction is due to the same enzyme or to another isoenzyme restricted to specific anaerobic growth conditions. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131210
View PSSM: TIGR02155
Aligned: 5 rows
Threshold Bit Score: 766.291
Threshold Setting Gi: 15807919
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6715111    15 EKASQDELRALQLERLKWSVRHAYENVPHYRKAFDAKGVHPDDLKSLADLAKFPFTAKGDLRDNYPFGMFAVPREKVARV 94
gi 27351154   40 ERASRDEIMALQKQRLGWSLKHAYDNVAHYRKAFDKAGVHPSDFRELSDLAKFPFTVKTDLRDNYPFNMFAVPREKLVRV 119
gi 13632704   11 ETASVDELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDLRKFPCTTKQDLRDNYPFDTFAVPMEQVVRI 90
gi 499198837   8 ETLSLEEKEKLQTYHLKSTVKLVYENVPFYRKAFQEVDVKPEDIQSLNDVQKLPFTQKHHLRENYPFHLLAVPLNEVVRL 87
gi 499191975   7 EALPLPQLRALQLAQLQVMVARQYERVPAYRAKFDALGVRPDDLQTLDDLARFPLTRKSDLRENYPLGLLATDRDQLRRI 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6715111    95 HASSGTTGKPTVVGYTLKDIDTWATVVARSIRASGGRAGDMVHIAYGYGLFTGGLGAHYGAEKLGCTVVPMSGGQTEKQI 174
gi 27351154  120 HASSGTTGKPIVVGYTQRDIDTWSEVMARSIRAAGGRTGMIIHNAYGYGLFTGGLGVHYGAEKLGCTVVPISGGMTERQV 199
gi 13632704   91 HASSGTTGKPTVVGYTQNDIDNWANIVARSLRAAGGSPKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQA 170
gi 499198837  88 HGSSGTSGKPTVVAYTQKDLEHWSSIIARSIYMAGGRKGDLLHNAYGYGLFTGGLGLHGGSEKLGCVTVPISGGNTQRQI 167
gi 499191975  87 HASSGTTGKPTVVAYDANDLNVFSDVVARSLYAAGGRPGMTFHNAYGYGLFTGGLGTHGGAERLGMCTVPISGGGTEKQV 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6715111   175 QLIQDFKPDIIMVTPSYMLTVLDEMERMG-IDPHQTSLKVGIFGAEPWTQAMRAAMEARAGIDAVDIYGLSEVMGPGVAN 253
gi 27351154  200 QLINDFRPDIITVTPSYMLAILDEFKRQK-LDPRQCSLKVGIFGAEPWTNAMRGEIEDAFDMDATDIYGLSEVIGPGVAQ 278
gi 13632704  171 QLIRDFQPDMIMVTPSYCLNLIEELERQLgGDASGCSLRVGVFGAEPWTQAMRKEIERRLGITALDIYGLSEVMGPGVAM 250
gi 499198837 168 TLIQDFKPRVICGTPSYIMNIGETMKKMG-IDPASTSIQYAILGSEPWSEEMRKNLETMFNMKAMDIYGLSEVIGPGVGM 246
gi 499191975 167 QLIQDLEPQIIACTPSYALVLAEALGRCG-MRPEDISLQYAVLGAEPWSNKTRTEVEARLGVKATNIYGLSEIIGPGVSN 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6715111   254 ECIEAKDGPVIWEDHFYPEIIDPHTGEVLPDGSEGELVFTTLTKEAMPVIRYRTRDLTRLLP---PTARS-MRRMAKITG 329
gi 27351154  279 ECIETKDGLHIWEDHFYPEVIDPETGAVLPDGEKGELVFTSLTKEGFPVIRYRTRDLTRLLP---GTARPgMRRMEKVTG 355
gi 13632704  251 ECLETTDGPTIWEDHFYPEIVNPHDGTPLADGEHGELLFTTLTKEALPVIRYRTRDLTRLLP---GTART-MRRMDRISG 326
gi 499198837 247 ECVECQNGLHIADDHFYPEIIDPITLECLPDGEEGELVFTTLQKEALPVIRYRTGDIASLTRepcECGRT-TARMSRVKG 325
gi 499191975 246 EDVSEQRGSYLWEDHFYPEILDPDTGEVLPDGEWGVLVLSSMTRTALPVLRYWTGDITRLLPaqnGTGRT-MRRMDQIRG 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6715111   330 RSDDMLIIRGVNLFPTQVEELICKNPKLAPQYLLEVDKDGHMDTLTVKVEINPEANVGRH-----PEQKealAKELQHDI 404
gi 27351154  356 RSDDMIILRGVNLFPTQIEEVLLATDWCGGHFILELTREGRMDELTIIAEARPESWDGRG-----LVDH---ADRISTHI 427
gi 13632704  327 RSDDMLIIRGVNVFPSQLEEEIVKFEHLSPHYQLEVNRRGHLDSLSVKVELK-ESSLTLT-----HEQRcqvCHQLRHRI 400
gi 499198837 326 RVDDMLIIRGVNVFPSEIEQCILKMDELDCHYQLHLVKNGALDEVALHVELKDEYYTLDLhgdlnHPHAsllKGKIQQTL 405
gi 499191975 325 RSDDLIILRGVNVYPTQLEAVLLGMGQASPHYHVILTRTGIMDDLTLQIEALSESAALR--------------QEIERQI 390
                        410       420       430
                 ....*....|....*....|....*....|....
gi 6715111   405 KTFIGVSAKVHVCEPFAIERvTI-GKAKRVVDRR 437
gi 27351154  428 KNTIGISSNVRVVAPATLER-SL-GKARRLYDKR 459
gi 13632704  401 KSMVGISTDVMIVNCGSIPR-SE-GKACRVFDLR 432
gi 499198837 406 KQEMLVSMDVHLKEPGTLPR-FE-GKAKRIVDKR 437
gi 499191975 391 KAQVGVTVRCELHVPGSLPR-SEgGKLRRVTDLR 423
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap