Conserved Protein Domain Family
PA_CoA_Oxy1

?
TIGR02156: PA_CoA_Oxy1 
phenylacetate-CoA oxygenase, PaaG subunit
Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131211
View PSSM: TIGR02156
Aligned: 5 rows
Threshold Bit Score: 518.633
Threshold Setting Gi: 15612759
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11072189   29 FDAKIDAGGYIEAKDWMPEAYRKTLVRQISQHAHSEIVGMLPEGNWITRAPTLKRKAILLAKVQDEGGHGLYLYAAAETL 108
gi 3253202    26 FQEKIDAEIKIEAKNWMPEAYRQTLIRQISQHAHSEIVGMLPEGNWVTRAPSLKRKLQLMAKIQDEAGHGLYLYSAMETL 105
gi 27351148   27 FQARIDAEERIEPNDWMPAAYRKTLTRQISQHAHSEIVGMLPEGNWITRAPTLRRKAALLAKVQDECGHGLYLYAAAETL 106
gi 653293256  13 FEARIARGEKIEPGDWMPAEYRRQLIRMISQHAHSEVVGMLPEGEWIARAPSLKRKTILMAKVQDEAGHGQYLYHAAETL 92
gi 499198838  24 FMEKIDSGKKIEADDWMPKDYRETLIKLISMHGISEIMGALPEKEWVPKAPTLYRKLGIMAKVQDEMGHGQLLLRVAEDL 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11072189  109 ----GVSRDELLDALHTGKAKYSSIFNYPTLTWADIGVIGWLVDGAAIMNQIPLCKCSYGPYARAMVRICKEESFHQRQG 184
gi 3253202   106 ----GADRDEEIAKLHSGKAKYSSIFNYPTLSWADMGAVGWLVDGAAIVNQVVLQRTSYGPYSRAMVRICKEESFHQRQG 181
gi 27351148  107 ----GASREELVDAMLAGKAKYSSIFNYPTLTWADIGTIGWLVDGAAIMNQIPLCRCSYGPYARAMIRVCKEESFHQRQG 182
gi 653293256  93 ----GVTREEMLDALLTRKAKYSSIFNYPTLTWADVGMIGWLVDGAAIKNQTMLAGCSYGPYSRAMVRICSEETFHHKQG 168
gi 499198838 104 lapyGKGREDLMIDLLNGDLKFHNVFHMETKTWADAGVIGWLVDGAAIISQTNMLDASYGPYQRALQRICAEEVFHAQHG 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11072189  185 YDLLLTMMK-GTQEQREMVQDAVNRWWWPSIMMFGPHDKDSVHSGQ---SARWGIKRISNDDLRQKFVDATVKQAEVLGV 260
gi 3253202   182 YEILLTMMRhGTQAQRDMVQDAINRLWWPSLMMFGPSDEHSPNSAQ---SMAWKIKRQTNDELRQRFIDQTVPQLELLGC 258
gi 27351148  183 YEIMLTLCR-GSDEQKAMAQDALNRWWWPVLMMFGPPDATSQHSDT---STKWKIKRFSNDELRQKFVDATVPQAQYLGL 258
gi 653293256 169 KEMMVLYAQ-GTPEQRQMAQDALNRWWWPAVQMLGPHDSDSPNTGA---LSKWGIKLKTNDEVRQEFINEHVPELLEAGL 244
gi 499198838 184 EAIIMALAE-GTETQRQMLQEALNRWWPALLMFFGPESAETTGSSKqevTTKYKIRKNSNEELRQAFLDKYLPRVFSLGL 262
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 11072189  261 TMPDPELKWNEERGHYDFGAIDWDEFWNVVNGHGQGNVDRLAARVKAWEDGAWVREA 317
gi 3253202   259 TAPDPELKWNAERGHYDFGEIQWDEFYEVIKGNGPCNQERVATRRKAIEDGAWVREA 315
gi 27351148  259 TIPDPGMTQDAE-GHWRYSEIDWTEFKQVLAGNGPCNRDRMAARRKAHEEGAWVREA 314
gi 653293256 245 TIPDPDLHQDEA-GNWVHGPIDWSEFWAVIKGEQGLGNERLATRQAAQDEGAWVREA 300
gi 499198838 263 TVPDETLYYNEDEKRWVYQQPNWNEFKQIIRNNGPRSKERLRLRKLAHEKNKWVREA 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap