Conserved Protein Domain Family
PA_CoA_Oxy5

?
TIGR02160: PA_CoA_Oxy5 
phenylacetate-CoA oxygenase/reductase, PaaK subunit
Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131215
View PSSM: TIGR02160
Aligned: 4 rows
Threshold Bit Score: 591.412
Threshold Setting Gi: 21225743
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13632702    4 FHSLTVAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSICRSYLPGEISVAVKAIEGGRFSRY 83
gi 11072193    9 FHPLKVAEVRRETPEAVSLRFEIPAELAEDYRFEQGQHLNLKVMVNGEELRRSYSICSGVDDNELRVAIKKIGGGVFSTW 88
gi 493822148  13 FNALTVSEVRRLTDDAVEISFEVPEELQADYDYIPGQYVALRTQLDGAEVRRSYSICDIPRPGTIRVAVKKNLGGLFSTW 92
gi 490069492  20 FHRLRVAAVERLCADAAAVSFEIPDELAGEFVFAPGQSLTLRREVDGRDERRSYSIC-APAGSAPRIGVRVVPGGLFSAW 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13632702   84 AREH-IRQGMTLEVMVPQGHFGYQPQAER------------QGRYLAIAAGSGITPMLAIIATTLQTEPESQFTLIYGNR 150
gi 11072193   89 ANDGgIRVGDVLEVMTPEGRFHTPLDPAH------------AKHYVAFAAGSGITPILSLVKTTLAAEPHSRFTLVYSNR 156
gi 493822148  93 ANEE-LKAGDTLEVMNPQGGFTSKTHVTSlndaetiaqeagNNHLVAVAAGSGITPIMAIAQTVLAENPKATFEIVYANK 171
gi 490069492  99 LVDE-VRPGDTVEVMAPTGLFTPDLSTP--------------GHHVLVAAGSGITPMVSIAESVLAADDRSTVTLFYGNR 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13632702  151 TSQSMMFRQALADLKDKYPQRLQLLCIFSQETLDSDLLHGRIDGEKLQSLGASLINFRLYDEAFICGPAAMMDDAETALK 230
gi 11072193  157 RQASVMFAETLEDLKNRHMARFTLYNLFSREEQEVPLFNGRLDGERVRQFLDTLIPVDTIDEAFICGPGAMIDEVEAALQ 236
gi 493822148 172 GGADVMFAEEIGDLKDKYPQRFAVHHVLSREQRVNPLFSGRIDDEKLNLLLDQVLRTDEVKEWFLCGPFELVQLCRDELE 251
gi 490069492 164 RTDTVMFADELADLKDLHPTRFHLAHVLSREPREAEVLSGRLDAGRLAALVGSLVDVERADHWWLCGPQGMVADAQQVLT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13632702  231 ALGMPDKTIHLERFNT------PGT--RVKRSVN-VQSDGQKVTVRQDGRD-REIVLNADDESILDAALRQGADLPYACK 300
gi 11072193  237 AAGLAHEHIHLERFGV------PAS--APEHHVEpGDATQAKVTVIADGLT-REMEFRAEDPSILDVALRAGMDLPYSCK 307
gi 493822148 252 GRGVDSANVRFELFTTgkpgdgPGQgnTGRPVIAdPEGDNITISFTLDGLSgTIESPSSARESVLNAALRARPDVPFACA 331
gi 490069492 244 GLGVPAGRVHRELFYAdd---ePVR--EVRHEESgPEGPVSEVTITLDGRS-T-TSSLSRERSVLDGAQQTRPDLPFACK 316
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|.
gi 13632702  301 GGVCATCKCKVLRGKVAMETNYSLEPDELAAGYVLSCQALPLTSDVVVDFD 351
gi 11072193  308 VGVCCTCRAKLLEGKVRMDKNFTLEQPDVDAGYILTCQAHPLIDRVVISFD 358
gi 493822148 332 GGVCGTCRAKVIEGEYEMEENYALEPDEVEAGYVLTCQTRPKGDTLVVDYD 382
gi 490069492 317 GGVCGTCRALVTDGSVDMRRNYALETAEVDAGYVLTCQSYPVSEKLTVDYD 367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap