Conserved Protein Domain Family
napC_nirT

?
TIGR02161: napC_nirT 
periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family
Nearly every member of this subfamily is NapC, a predicted membrane-anchored four-heme c-type cytochrome that forms one component of the periplasmic nitrate reductase along with NapA, NapB, NapD, NapE, and NapF subunits. A single known exception at this time is NirT, which is instead a component of a nitrite reductase. This family excludes TorC subunits of trimethylamine N-oxide (TMAO) reductases.
Statistics
?
PSSM-Id: 131216
View PSSM: TIGR02161
Aligned: 10 rows
Threshold Bit Score: 347.143
Threshold Setting Gi: 37201398
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 90110036    6 FLRRFWSIATSPSsFLSVGFLTLGGFVGGVLFWGGFNTALEATNTEAFCTSCHEMQSNVFEELTRTVHYTNRSGVRAGCP 85
gi 2493991    14 RVTWFWRVISRPSsFLSIGFLTLGGFICGVIFWGGFNTALEITNTEKFCTSCHEMRDNVYQELMPTVHFSNRSGVRASCP 93
gi 14278965   11 VLREWWATLRRPSgRWSLGLLLVVGFVGGVIFWGGFNTVLELTNTEAFCLSCHEMEQNVYREYRGSIHDSNRSGVRATCP 90
gi 128347     10 QKGGILALLRRPStRYSLGGILIVGIVAGIVFWGGFNTALEATNTETFCISCHEMGDNVYPEYKETIHYANRTGVRATCP 89
gi 37201398    3 LLKAFWKRLSTPS-KAAAGILLFMGFAGGLLFWGAFNTGMEATNSEEFCSGCHAP---IVAEIQETIHYSNRSGVRAICS 78
gi 465627     10 LIKRLWKWWRTPS-RLALGTLLLIGFVGGIVFWGGFNTGMEKANTEEFCISCHEMRNTVYQEYMDSVHYNNRSGVRATCP 88
gi 12721994    4 LIKRFWKWFRSPS-RIAVGTLITLAFIAGIVSWVGFNYGLEQTNTEEFCVSCHSN--DVYPEYLHTAHYLNRSGVKATCP 80
gi 1171647     8 ILKRFWQWFRKPS-RMAIGTIIILSAIGGILSWVGFNYGLEKTNTEQFCASCHMQ--DAYPEYLHSVHYQTRTGVGASCP 84
gi 33147566    1 MFKAGVNWLRRPS-KMALGLLILIISACTLIAWSGFNVVLEKTNTEQFCSDCHMN--DVVPEYRASAHYSNRSGVKAVCA 77
gi 665934686   7 WLAGYWRVLRRPSvHFSLGFLTLGGFIAGIVFWGGFNTALEATNTETFCISCHEMRDNVFVELKDTIHYSNRSGVRATCP 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 90110036   86 DCHVPHEWTDKIARKMQASKEVWGHLFGTIDTRRKFLDNRLRLAEHEWARLKANDSLECRNCHSEVAMDFTRQTDRAAQI 165
gi 2493991    94 DCHVPHEWTDKIARKMQASKEVWGKIFGTISTREKFLEKRLELAKHEWARLKANDSLECRNCHAAVAMDFTKQTRRAPQI 173
gi 14278965   91 DCHVPRPWIYKIQRKIQASNEVWHKLLGSIDTREKFEAKRIELAKHEWERMKSTDSRECRNCHNFGAFDLTRQQARARNR 170
gi 128347     90 DCHVPRDWTHKMVRKVEASKELWGKIVGTIDTAEKFEAKRLTLARREWARMRASDSRECRNCHSLESMSSDMQKQRARKQ 169
gi 37201398   79 DCHVPHEWTDKIVRKVQASKELFAHFIGTIDTPEKFQERRAHLAEREWARLKKNDSLECRNCHEFEYMDFSEQGARSAKQ 158
gi 465627     89 DCHVPHEFVPKMIRKLKASKELYGKIFGVIDTPQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFEYMDTTAQKSVAAKM 168
gi 12721994   81 DCHVPHEFIPKMIRKVQASREVYAHLMGYTDTIDKFNSRRLHMAEREWARLKANNSQECRNCHNFENMDFSQQKTVAEKM 160
gi 1171647    85 DCHVPHEFGAKMKRKIIAAKEVYAHYTGKVDTLEKFNAHRLEMAQNEWARMKANDSKECRNCHNVDRMTFNDQRSVAARM 164
gi 33147566   78 DCHVPHEFAPKMLRKLQASTEVYAHLTGKVDNKEKFEAHRLAMAEREWARMKANNSQECRNCHNFEDMDFTQQKTVAQQM 157
gi 665934686  87 DCHVPHKWTDKIARKMQASKEVWGKIFGTINTREKFLDHRRELAEHEWARLKANDSLECRNCHNFEFMDFTRQSVRARQM 166
                        170       180
                 ....*....|....*....|....*...
gi 90110036  166 HTQYLIQTEgyTCIDCHKGIAHELPDMR 193
gi 2493991   174 HERYLISGEk-TCIDCHKGIAHQLPDMT 200
gi 14278965  171 HSEAEQQGK--TCIDCHKGIAHQLPAGA 196
gi 128347    170 HEMAREDNL--TCIACHKGIAHHLPEGM 195
gi 37201398  159 HSTALASGEk-TCVDCHKGIAHKLPDMH 185
gi 465627    169 HDQAVKDGQ--TCIDCHKGIAHKLPDMR 194
gi 12721994  161 HALAIKEEK--TCIDCHKGIAHQLPDMS 186
gi 1171647   165 HQKMKTEGK--TCIDCHKGIAHQLPDMS 190
gi 33147566  158 HSRAETENK--TCIDCHKGIAHNLPHME 183
gi 665934686 167 HSTALASGEa-TCIDCHKGIAHHLPDMT 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap