1B0P


Conserved Protein Domain Family
pyruv_ox_red

?
TIGR02176: pyruv_ox_red 
Click on image for an interactive view with Cn3D
pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric
This model represents a single chain form of pyruvate:ferredoxin (or flavodoxin) oxidoreductase. This enzyme may transfer electrons to nitrogenase in nitrogen-fixing species. Portions of this protein are homologous to gamma subunit of the four subunit pyruvate:ferredoxin (flavodoxin) oxidoreductase.
Statistics
?
PSSM-Id: 131231
View PSSM: TIGR02176
Aligned: 7 rows
Threshold Bit Score: 2154.88
Threshold Setting Gi: 21647632
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A          4 MMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALTTTF 83
gi 34396674     7 FLTCDGNQAAAHIAYMFSEVAAIYPITPSSTMAEYVDDWAAAGRKNIFGETVRVQEMQSEAGAAGAVHGSLQGGALTTTF 86
gi 1770208      5 MMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALTTTF 84
gi 29344130     4 MKTMDGNAAAAYISYAFTELAAIYPITPSSTMAELVDQWSAEGKKNIFGQPVKVVEMQSEAGAAGVVHGSLKTGALTTTY 83
gi 21647632     5 FKTMEGNEALAHVAYRTNEVISIYPITPASPMGEYSDAWAAVDVKNIWGTVPLVNEMQSEAGAAAAVHGALQTGALTTTF 84
gi 499268401    5 LKTMDGNEAAAYASYAFTDVAAIYPITPSTPMAELVDNWSSHGRKNIFGQPVKIVEMQSEAGAAGTVHGSLIAGALTTTY 84
gi 41816292     7 LVMIDGNTAAGHVAHALSEVIAIYPITPSSPMGEVADEYSARGRENIWGTVPDVVELQSEGGAAGAVHGALTTGALSSTF 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A         84 TASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESN 163
gi 34396674    87 TASQGLLLMIPNMYKIAGELLPCVFHVSARTIASHALSIFGDHQDVMAARQTGFAQLCTGSVQEVMDLAGVAHLATLRTR 166
gi 1770208     85 TASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESN 164
gi 29344130    84 TASQGLLLMIPNMYKIAGELLPSVFHVASRALTTNALNIFGDQGDVMAARQTGFAMLSESSVQEVMDLAPVAHLASIEAS 163
gi 21647632    85 TASQGLLLMIPNMYKIAGELTPCVIHVSARSLAAQALSIFCDHGDVMSVRGTGFALLASCSVQEVMDMALISQAATLESR 164
gi 499268401   85 TASQGLLLMIPNMYKMAGELLPCVFHVSARAIATHALSIFGDHQDVMAARQTGFVLLASSNVQEVMDLAMVSHLAAIKAR 164
gi 41816292    87 TASQGLLLMIPNMYKIAGELTSTVFHIAARAVACSALSIFGDHQDVMACRQTGWAMLASNSVQEVMDLAIISHAATLEAR 166
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        164 VPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVA 243
gi 34396674   167 IPFIHFFDGFRTSHEIQKIEALDNEDLARFIDWDDVKRFRKQALNPESPVTRGTAQNGDIYFQNREACNRFYDAVPEAVQ 246
gi 1770208    165 VPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVA 244
gi 29344130   164 VPFMNFFDGFRTSHEIQKVAVLDYEELAPLVNQEKLAEFHRRSMNPNHPSVSGMNQNPDIHFQQRETINPYYEKLPGIVQ 243
gi 21647632   165 VPFLHFFDGFRTSHEISKIEVLSDEQIRSMINDELVFAHRMRRMSPDAPIIRGTSQNPDVYFQARESVNKYYEACPSITQ 244
gi 499268401  165 VPFMHFFDGFRTSHEYQKIEMIDYNDVAPLVDYESIKAFRSRALNPEHPTVRGTAQNPDIYFQGREASNNFYTAVPDIVE 244
gi 41816292   167 VPFLHFFDGFRTSHEIQKIEEVSYDIMRQMVSDELVRAHRKRGLTPEKPELRGTAQNPDIYFQGREAVNKYYLATPEIVQ 246
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        244 EYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVI 323
gi 34396674   247 YYMDQLATVTGRHYHLFDYYGDPEAEHVIIAMGSVTEAIREVIDFLRAKGEKVGLLSVHLYRPFSAKHFLAAMPKTVKRI 326
gi 1770208    245 EYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVI 324
gi 29344130   244 KYMTEINRLRGTNYDLVTYYGAEDAEEVIVTMGSVAQTIEQTVDYLQQQGRKVGFLNVHLYRPFPIETFLEKVPQSVKAI 323
gi 21647632   245 KAMDQFAKLTGRSYKLYQYYGAPDADRIIIMMGSGAETALETVEYLNNHGEKVGLVKVRLFRPFDVATFIASLPSSVKSI 324
gi 499268401  245 SYMREIEKITGRVYHPFDYYGDPEAEDIIIAMGSVCDTVEETVDYLRSKGQKVGLLKVHLYRPFSTDYFFKYLPKTIKRI 324
gi 41816292   247 KQMDKYAKLTGRQYHLYDYYGAKDAEQIIILMGSGADTVEETVDELNSKGGKYGVIKVRLYRPFSAEHFVKAIPTTVKGI 326
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        324 TVLDRTKEPGAPGDPLYLDVCSAFVERg-------EAMPKILAGRYGLGSKEFSPAMVKSVYDNMSG---AkKNHFTVGI 393
gi 34396674   327 AVLDRTKEPGATGEPLYLDVRDCYYGM--------EDAPLIVGGRYGLSSKDTTPAQMKAVFDNLKLn--VpKDHFTVGI 396
gi 1770208    325 TVLDRTKEPGAPGDPLYLDVCSAFVERg-------EAMPKILAGRYGLGSKEFSPAMVKSVYDNMSG---AkKNHFTVGI 394
gi 29344130   324 AVLDRTKEPGAGGEPLLLDVQSAMYEA--------DIRPTIIGGRYGLGSKDVLPNQIVAVFDELMKersAmKKRFTIGI 395
gi 21647632   325 AVLDRVKEPGSAGEPLYLDVVNAVAESyqe--gkcASMPSVLGGRYGLSSKEFTPAMVKAIFDNMNAe--SpKNHFTVGI 400
gi 499268401  325 AVLDRTKEPGSAGEPLYLDVVNAFYNH--------PNKPVIVGGRFGLGSKDTRPSQILSVFDNLRAq--SpKNRFTIGI 394
gi 41816292   327 AVLDRCKEAGSLGEPLYEDVRTAIGEMqaakkcpfTHYPVIIGGRYGLGSKEFTPAMVKGVFDNLEGe--K-KTNFSVGI 403
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        394 EDDVTGTSLPVDnAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKP 473
gi 34396674   397 VDDVTFTSLPLG-EDLIFDNPSLVEAKFYGLGADGTVGANKNSVKIIGDNTNKYCQAYFAYDSKKSGGFTCSHLRFGDTP 475
gi 1770208    395 EDDVTGTSLPVDnAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKP 474
gi 29344130   396 DDDLTYTSLEVG-KPLDLTNPKTYQAKFWGFGSDGTVGANKSAIKIIGDHTDKYAQGFFYYDSKKSGGLTVSHLRFGETP 474
gi 21647632   401 DDDVTKKSLAYD-ETFSIEPDSVFRALFYGLGSDGTVGANKNSIKIIGENTDNYAQGFFVYDSKKAGSITTSHLRFGPEQ 479
gi 499268401  395 VDDVSNTSLPEG-EIIDTTPQGTIRCKFYGLGSDGTVGANKSAIKIIGDNTDMYCQAYFSYDSKKSGGSTVSHLRFGNKP 473
gi 41816292   404 EDDVTHTSIKYD-PNFKLEDKDMHQAMFFGLGSDGTVGANKNSIKIIGEATDNKAQAYFSYDSKKSGGFTISHLRFGKHA 482
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        474 IQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWsS-LEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDV 552
gi 34396674   476 IRSTYLVVTPDFVACHVPAYLRMYDVLKGLKKKGTFLLNSIW-A-PEDIEQHLPNKVKRYLAKNNIRFYTINATAIAQQI 553
gi 1770208    475 IQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPW-SsLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDV 553
gi 29344130   475 IRSTYLIEHSDFVACHTAAYLHTYDLVKGLKKGGTFLLNTIW-N-DEQLARFLPNQLKRYLAENEIQFYTINAVKLASEV 552
gi 21647632   480 IRSTYLITEAQFVGCHHWVFLEMIDVAKNLKQGGTLLINSAY-A-PDVVWSKLPRPVQQHLIDKQAKLYTIDAYKVAHES 557
gi 499268401  474 IKSPYLVYEADYIACHNKSFIYNINVLKGLKKNGIFVLNCPF-K-DNELDEHLPNAMKKYIADNNIQFYTIDAVSIAQEV 551
gi 41816292   483 IRKPYLITNADFVACHKFSYLETYDMLHSLKKGGTFLLNAPY-G-KNEIWDNMPVEVQKQIIEKEAKFYVIDAIKIAEKA 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        553 GLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVtSLQEFKYPDSWKDAPAETKA-E 631
gi 34396674   554 GLGNRTNTILQSAFFKIANVIPYDLAVEQMKKFIVKSYGKKGEDVVNKNFAAVDRGG-DVVEITVKPEWADLPDDPVVrH 632
gi 1770208    554 GLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVtSLQEFKYPDSWKDAPAETKA-E 632
gi 29344130   553 GLGGRINTAMETAFFKLAEIMPFEQVLPILKEEALKSYGHKSMKVVEKNIQAIDKTVeLLHQVPVPAEWRTLEVQPRKrS 632
gi 21647632   558 GMGQRINTIMQACFFAISGVLPREEAIEKIKDAIRHTYGKKGDEVVQQNIKAVDNTLaNLHEVKIGAVADSTKELRSPiV 637
gi 499268401  552 GLGSRINMIMQSAFFKLANIIPVDKAVQYLKDSIEYTYGKKGATIVDANKKAVDAGVnAAHKVTVPEAWKNAESNYQP-L 630
gi 41816292   561 GMGNRINVVMQTAFFKIFGILPEAEAVDLIKKFIEKSYGKKGPEIVQKNITTIDMALeGVEKVDYPKTATSKLKMHPAiA 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        632 PMTNEFFKNVVKPILTQQGDKLPVSAFEA----DGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVL 707
gi 34396674   633 EGDTDFVHNVVRPINAQAGDDLPVSAFLGr--eDGTWDSGTAASEKRGVAAFVPVWEADNCVQCNQCAYVCPHATIRPFV 710
gi 1770208    633 PMTNEFFKNVVKPILTQQGDKLPVSAFEA----DGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVL 708
gi 29344130   633 ENVSDFVHEIVEPINRQEGNALSVATLAKngmtDGRMPLGTAAVEKRGVALEVPEWISDRCTMCNECAFVCPHAAIRPFL 712
gi 21647632   638 GDAPEFVCNVLAKIIAGEGDSIPVSKLPA----DGTYPLGTTKFEKRNLAQEIPVWAPELCIECGKCSMVCPHAAIRIKV 713
gi 499268401  631 KGLPDFVQRIERPMARHEGDELPVSAFKGm--eDGVFPLGITAYEKRGIAVNVPEWQIDKCIQCNQCAYVCPHSVIRACL 708
gi 41816292   641 GDAPEFVKNVLGKVAIQKGDDIKVSEMPE----DGTFPTATTQYEKRAIAEHIPIWKSDICIQCGQCVMVCPHACIRMKA 716
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        708 AKEEELVGApaNFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPK----E--KALVMQPLDTQRDaQVPNLEYAA 781
gi 34396674   711 LTKEEEEKT--GVKVLKAVGKQFPDMGFRIQVNVMDCLGCSNCVDVCPGN----KngKALTMQPIEEQYE-EQKNWDKMI 783
gi 1770208    709 AKEEELVGApaNFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKe------KALVMQPLDTQRDaQVPNLEYAA 782
gi 29344130   713 ADEEEMTEApeGFIVRDLRG--ADGLKYRIQVSVKDCTGCGLCVEACPAKg------KALVMKPYEEEKE-QAMNWAFAM 783
gi 21647632   714 YEPKHLENApaTFKSLDAKAKNWEGMRYTVQIAPEDCTGCQLCVNACPARdkqvEgrKALNMHEQAPLREtESACWSFFI 793
gi 499268401  709 LDDEEKENApeRFVTKKPVGKGLEHLHYKIQISPLDCTGCGNCADICPAPg------KALIMKPAAEQIEeQSENFEYAL 782
gi 41816292   717 YDSSLLAKApqGFKSCDYKGKEFEGAKFTIQVSSEDCTGCGLCVQQCPAKskenPeiKAINMENFVEHRKqEVANWNFFF 796
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        782 R-IPVKS-EVLPRDS-LKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLG 858
gi 34396674   784 SgVTGKA-HLVDIAAnVKNSQFATPLFEFSGACSGCGETPYVKLITQLYGDRQTVANATGCSSIYSASAPSTPYTKNERG 862
gi 1770208    783 R-IPVKS-EVLPRDS-LKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLG 859
gi 29344130   784 T-LRQKE-NPAKPNT-VLGSQFNKPLLEFSGACSGCGETPYVKLLTQMFGDRMLIANATGCSSIWGAAAGVTPYTTNEQG 860
gi 21647632   794 N-LPEFDrNKINQRL-IKEQQLQQPLFEFSGACSGCGETPYVKLMTQLFGDRLVIGNATGCSSIYGGNLPTTPYAANPQG 871
gi 499268401  783 K-VKPKE-GIMDIHT-VKGSQFSRPLLEFNGACPGCGETPYIKLLTQLYGDRMMIANATGCSSIWGASAPSIAYTTNNFG 859
gi 41816292   797 NdIPEPDvKKLNLSV-PKGIGMKRPLFEFSGACAGCGETPYVKLLSQLFGDRAVIANATGCSSIYGGNLPTTPYAKRCDG 875
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        859 QGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESD-ASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQK 937
gi 34396674   863 EGPAWANSLFEDNAEFGLGMHLAYKKMRRRLVNLAEEAQQSPcCSDELKALLREWVEKRQDAVASKVLADKIKPLVAACD 942
gi 1770208    860 QGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESDaS-GDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQK 938
gi 29344130   861 QGPAWSNSLLEDNAEFGYGMLLATQARRERLASKMTKAFSv--ASDSLRLLMEDWIAHLSESEGTQQRAAKLRAALLEEK 938
gi 21647632   872 LGPTWSNSLFEDTAEFALGFRISIDKQQQFAKELVKKLAGDi-GENLATAILNATQNSEPEIFEQRERVAVLKDKLQQMK 950
gi 499268401  860 KGPSWGNSLFEDNAEYGYGMFLGVKQMRERLAELMEEAINSNiN-SDLKDAFSLWLDGFDDGDKSKEASNKILRIMENED 938
gi 41816292   876 RGPAWSNSLFEDAAEFGYGMRLTSDKLAVYAREVAAKAKAKGiAAGVIDKILNNAQEDDAAIEDQRAFVAELKKELAGSK 955
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A        938 ---DGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAA 1014
gi 34396674   943 ---CDICKRIGRVDSFFIKRAQWIIGGDGWAYDIGFGGLDHVIASGMNVNILVLDTEVYSNTGGQSSKSTPIGAIAKFAA 1019
gi 1770208    939 ---DGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAA 1015
gi 29344130   939 t-nQPLLEAIYDDQDLFVKPSQWMIGGDGWAYDIGYGGIDHVLASGADVNMLVLDNEVYSNTGGQTSKATPASAIAKFAA 1017
gi 21647632   951 ---SDDAKNLLAVADMLVKKSVWAVGGDGWAYDIGYGGLDHVTASGKNVNMLVLDTEVYSNTGGQASKATPKAAIAKFAA 1027
gi 499268401  939 fkgDKLLSEIYDKKDYLVKKSHWLIGGDGWAYDIGFGGVDQVLALGDDVNIFVMDTEIYSNTGGQSSKSTPTGAIAKFAS 1018
gi 41816292   956 ---DELAKELDSLTDHFIKRSVWILGGDGWAYDIGYGGLDHVLASGKNINVLVMDTEVYSNTGGQMSKATPIGAVAKFAA 1032
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B0P_A       1015 AGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGksQDVMNTAVKSGY 1094
gi 34396674  1020 AGKRIRKKDLGMIAATYGYVYVAQVSIGANPAQTLKAIREAEAYDGPSIVIAYSPCISHGIKSGMGktQAEGKRAVECGY 1099
gi 1770208   1016 AGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGksQDVMNTAVKSGY 1095
gi 29344130  1018 SGKYASKKDLGMMAMTYENVYVAQIASGANQMQTIKAFEEAEKFPGPSIIIAYTPCITHGLAGGMSqtLKEAKDAVHSGY 1097
gi 21647632  1028 AGRIATKKDLGLISMSYGNAYVASVALGARDEQTLRAFIEAEAYDGPSIIIAYSHCIAHGFDLSMG--LEHQKAAVDSGH 1105
gi 499268401 1019 AGKKTRKKDLGLMAMTYGNVYVTQIAMGANMTHTIKAITEAEAYKGPSLVIAYAPCISHGIKTGMGtsIAQEKKAVEAGY 1098
gi 41816292  1033 SGKEVSKKDLGMMAMSYGYVYVAHISMGANMSQVIKAFREAESYDGPSIIIAYSHCINHGINMTKG--MTNQKEAVSCGL 1110
                        1130      1140      1150      1160      1170      1180      1190
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
1B0P_A       1095 WPLFRYDPRLAAQGKNPFQLDSKAP-DGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAA 1167
gi 34396674  1100 WHLWRYNPELEKEGKNPFQMDSKEPnWSEFKNFLKGEVRYASLYKEFPEDAEQLFDAAFENAQWRYRNYMRMSA 1173
gi 1770208   1096 WPLFRYDPRLAAQGKNPFQLDSKAP-DGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAA 1168
gi 29344130  1098 WSLYRYNPLLREKGKEPMILDFKKPdFSLMKEFMRQQVRFASLESSQPDTAELLFNKTINDAKRRFYNYARLAG 1171
gi 21647632  1106 WLLYRYNPDRLKEGLNPLQLDSKKP-KMPVAEFLNMENRFRILKKTHPDLAKKYFEAIQHEVNARWAHYEHLAN 1178
gi 499268401 1099 WHLYRYNPLLKEQGKNPFILDSKEP-TESYTDFINGELRYSSLKTIFPDKVEDAFNKSAENAKERYSLYKKLSE 1171
gi 41816292  1111 WPLYRYDPRLVEQGKNPFQLDSKEP-DFNLADFMYKEVRFKTLKNADPARAQMLLDKAVAKAKRQWQEYKYLAD 1183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap