Conserved Protein Domain Family
yeiP

?
TIGR02178: yeiP 
elongation factor P-like protein YeiP
This model represents the family of Escherichia coli protein YeiP, a close homolog of elongation factor P (TIGR00038) and probably itself a translation factor. Member of this family are found only in some Gammaproteobacteria, including E. coli and Vibrio cholerae. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 131233
View PSSM: TIGR02178
Aligned: 3 rows
Threshold Bit Score: 326.069
Threshold Setting Gi: 31563071
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878945   3 RANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYVDFSYVDGNEY 82
gi 31563227   3 KASELKKGFAIISNGKTLLIKDIEVTTPGGRGGSKIYKLRCTDLNTGARVDERYKSDDVLDTVEMNKRPISFSYIDGDEY 82
gi 31563071   2 KASEMKKGSIVEYSNGTYQIRDIQRSSPQGRGGNVRFRFVMYSVPGGSKLEASFDADEMLTAVELLRREASFSYKDGEAF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878945  83 VFMDKEDYTPYTFTKDQIEEELLFMPEGgMPDMQVLTWDGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGL 162
gi 31563227  83 VFMNNDDYTPYNFKKDEIEDELLFITEE-IQGMSVVLVDGEAVAIELPSSVEMVIEETDPSIKGASASSRTKPARMPTGL 161
gi 31563071  82 VFLDEEDYTLYTLDAEAIGDNAGYISEG-LSGCYVQLIDASPVALQLPQHVVLEVVDTPPELKGGTATKRPKPAKLITGI 160
                       170       180
                ....*....|....*....|....*..
gi 13878945 163 VIQVPEYLSPGEKIRIHIEERRYMGRA 189
gi 31563227 162 VVQVPEYIATGDRIVINTAERKFMNRA 188
gi 31563071 161 EVMVPEYITTGERILVNTTTGAFGGRA 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap