Conserved Protein Domain Family
GlrX-dom

?
TIGR02190: GlrX-dom 
Glutaredoxin-family domain
This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.
Statistics
?
PSSM-Id: 131245
View PSSM: TIGR02190
Aligned: 5 rows
Threshold Bit Score: 150.76
Threshold Setting Gi: 33148096
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33576425  164 APQARKPDQVVVFSKPGCPFCVDAKALLKGKGFDPIEIPLDNKVRGRVIGAVSGGDTAPQVFINGKLIGGFDALKAYLA 242
gi 34103346  164 NPSAKKPDQVVVFTKVGCPHCARAKAVLAENGYDFVEVPLDNKIRGKVLGAVSGAMTAPQVFINGELIGSADEVEKRFA 242
gi 28807763  164 APEYRTQESITVFTKPGCPFCMKAKQNLIDHGLQYEEVILGKDATSVSLRAITGRTTVPQVFIGGKHIGGSEELETYLG 242
gi 33148096  165 VAGWQAKESVSIITKPGCPFCAKAKETLKAKGYAFEEIVLGRDASTISVRAITGKTAVPQVFIGGKHIGGSDELTAYFA 243
gi 499304935 164 NPQAAKPKLVSLFTKVGCPFCARAKAALQENGIEYEEITLGKGITTRSLRAVTGATTVPQVFIDGVLIGGSEALTDYLS 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap