Conserved Protein Domain Family
rfaE_dom_II

?
TIGR02199: rfaE_dom_II 
rfaE bifunctional protein, domain II
RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in E. coli, and separate proteins in some other genome. Domain I (TIGR02198) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (this family) adds ADP to yield ADP-D-glycero-D-manno-heptose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131254
View PSSM: TIGR02199
Aligned: 14 rows
Threshold Bit Score: 225.645
Threshold Setting Gi: 27354204
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 555666     18 ALAARIAALPRPLVFTNGVFDILHRGHATYLAQARALGASLVVGVNSDASVKMlGKGDDRPLNHESDRMALLAALESVDL 97
gi 39984073  342 GIIAAEKAQGKRVVFTNGCFDLLHVGHVKYLQKARSFGDLLVLGLNSDASIRR-LKGEKRPLIGQEERAHILAALDCIDY 420
gi 45600651   15 AFADQVRKN-KKIVFTNGCFDLVHKGHITYLSQARELGDFLWIGLNSDSSVKR-LKGEQRPLICEEDRAILLSNLRFVDA 92
gi 12230540  324 TLER----NQQKIVFTNGCFDILHKGHASYLQKAKALGDILVVGLNSDNSIKR-LKGDKRPIVSEKDRAFLLASLSCVDY 398
gi 13425394  340 RIVEGWRARGLKVGFTNGCFDLLHPGHVSLLSQAKAACDRLIVGLNTDASVSK-LKGPTRPVQKEQGRATVLASLSSVDL 418
gi 27354204  348 AQLAEWRTQGLRVGFTNGCFDILHPGHVKVLTAARGACDRLVVGLNSDASVRR-LKGADRPVQDERARAEVLAALEAVDL 426
gi 22770298  330 RAVEQAKQRGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNTDESVKR-LKGESRPINDLNARMAVLAGLASVDW 408
gi 33517206  332 YVVSVVRGRGEKIVMTNGVFDILHYGHISYLMDAKKLGHRLIVAVNSDKSTRR-LKGKHRPINVLERRMFVLSALSMVDW 410
gi 28855351  329 LAVDDARAHKEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVNDDASVSR-LKGPGRPINSVDRRMAVLAGLGAVDW 407
gi 499182530   9 lkvlereRKGKKVVFTNGCFDIIHAGHVDYLEKAKKLGDILVVGMNSDSSVRR-IKGERRPIIPQEMRAKVLSSLKPVDY 87
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 555666     98 VAMFREQTPVELIRLVRPDIYVKGGDYDIDTLEETRLVRSWGGQAYAIPFLHDRSTTKLLTRVRQ 162
gi 39984073  421 VVVFDEDTPLNLIETLRPAVLVKGGDYTLDGVVGREVVESYGGRVELVAFVDGRSTTNIIEKILK 485
gi 45600651   93 VTIFSQDTPLDLIRLIKPKIHVKGGDYKVEELPETKIIRELGGDVQILPFVPGKSTSSIIEKILK 157
gi 12230540  399 VVVFGEDTPIKLIQALKPDILVKGADYLNKEVIGSELAK----ETRLIEFEEGYSTSAIIEKIKR 459
gi 13425394  419 VVLFDEDTPLELIKAFRPDVLVKGADYTVETVVGSDVVLGYGGKVVLAELKQGQSTTNLIARMNS 483
gi 27354204  427 VVIFEEDTPIDLITRIKPAALVKGGDYTREQVVGHEVVEAAGGVVVLVDILQGFSTTALVHRARG 491
gi 22770298  409 VVPFAEDTPQRLIGEILPNLLVKGGDYKPEEIAGSQEVWANGGEVKVLNFENGCSTTNVIKKIQA 473
gi 33517206  411 VVSFDEDNPIQLILEISPDFLVKGGDYNVNNIVGGKEVLRQGGQVCVLKFQEDCSSSSIIDTMEI 475
gi 28855351  408 VISFPEGTPENLLTHVKPDVLVKGGDYGIDQVVGADIVQAYGGEVRVLGLVENSSTTAIVEKIRG 472
gi 499182530  88 VVIFEEDTPEKLIKAIKPDVLVKGGDWPLDKIVGREFVESYGGKVLTIPFEYDISTSKIVQKVLE 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap