Conserved Protein Domain Family
heptsyl_trn_III

?
TIGR02201: heptsyl_trn_III 
lipopolysaccharide heptosyltransferase III, putative
This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131256
View PSSM: TIGR02201
Aligned: 3 rows
Threshold Bit Score: 578.398
Threshold Setting Gi: 34102130
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5006986    15 RILVIKLRHHGDMLLITPLIHALKQQYPAASVDVLLYEETRDMLAANPDIHHIYGLDRRWKkqGKRyQLKMQWQLIQTLR 94
gi 34102130    9 RILLIKLRHHGDILLTTPVARTLKSRFPQCEIDMLVYRETVPLLQHNPDIARVWTLDRSLR--GWR-KLVSQLRLLLALR 85
gi 446282547   7 RILLIKMRFHGDMLLTTPVISSLKKNYPDAKIDVLLYQDTIPILSENPEINALYGIKNKKAkaSEK--IANFFHLIKVLR 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5006986    95 QQRYDMVLNLADQWPSAVISKLTGAATRIGFDFPKRRHPVWRYCHTALASTQQHNQLHTVQQNLSILAPLGLQLNDAPAR 174
gi 34102130   86 RRRYQTVIHLSDQMQGAFFAKLLARRHAIGFDYPKRRKSPWHRFFTALAPLAPSDTLHTVSQNLLALSPLGITPTADEQR 165
gi 446282547  85 ANKYDLIVNLTDQWMVAILVRLLNARVKISQDYHHRQSAFWRKSFTHLVPLQGGN---VVESNLSVLTPLGLDSLVKQTT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5006986   175 --MGYSEADWAASRALLPED-CREHYIVIQPTSRWFFKCWREDRMSALINALSAEGYAVVLTSGPDAREKKMVDTIIAGC 251
gi 34102130  166 cvLPIQASDREAVAALLREAgVSGPYIVIHPSSRWFFKCWEDDRFAGLAEALASDGWSIVLTAAPDPAEMDMVAAIQGKI 245
gi 446282547 162 --MSYPPASWKRMRRELDHAgVGQNYVVIQPTARQIFKCWDNAKFSAVIDALHARGYEVVLTSGPDKDDLACVNEIAQGC 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5006986   252 PQARLHSLAGQLTLRQLAAVIDHARLFIGVDSVPMHMAAALGTPLVALFGPSKLTFWRPWQAKGEVIWAGDFGPLPDPDA 331
gi 34102130  246 RSDRVVSVAGRLTLNQLAAIIDGARMFIGVDSVPMHMAAALGKDTVALFGPSKIHEWHPWMTRHRLLNAADYGELIDPDQ 325
gi 446282547 240 QTPPVTALAGKVTFPELGALIDHAQLFIGVDSAPAHIAAAVNTPLISLFGATDHIFWRPWSNNMIQFWAGDYREMPTRDQ 319
                        330       340
                 ....*....|....*....|....*..
gi 5006986   332 INTNTDERYLDLIPTDAVIAAAKKVLA 358
gi 34102130  326 VDTSTRQRYLKNIPLEAALRASRELLS 352
gi 446282547 320 RDRN--EMYLSVIPAADVIAAVDKLLP 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap