Conserved Protein Domain Family
Ehrlichia_rpt

?
TIGR02202: Ehrlichia_rpt 
Ehrlichia chaffeensis immunodominant surface protein repeat
This model represents 77 residues of an 80 amino acid (240 nucleotide) tandem repeat, found in a variable number of copies in an immunodominant outer membrane protein of Ehrlichia chaffeensis, a tick-borne obligate intracellular pathogen.
Statistics
?
PSSM-Id: 131257
View PSSM: TIGR02202
Aligned: 2 rows
Threshold Bit Score: 100.347
Threshold Setting Gi: 27413846
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27413846  50 QEDDTVSQPSLEPFVAESEVSKVEQEKTNPEVLIKDLQDVASHESGVSDQPAQVVTERENEIESHQGETEKESGITE 126
gi 27413850 130 KEDEIVSQSSSEPFVAESEVSKVEQEETNPEVLIKDLQDVASHESGVSDQPAQVVTERESEIESHQGETEKESGITE 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap