3B5W


Conserved Protein Domain Family
MsbA_lipidA

?
TIGR02203: MsbA_lipidA 
Click on image for an interactive view with Cn3D
lipid A export permease/ATP-binding protein MsbA
This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 131258
View PSSM: TIGR02203
Aligned: 7 rows
Threshold Bit Score: 896.769
Threshold Setting Gi: 24986705
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A        12 TFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFG-----------------------------KTDRS 62
gi 127339     12 TFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFG-----------------------------KTDRS 62
gi 28056348   16 TYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALMKPITNETFIe-----------------------------RNRE 66
gi 33576803   19 LWKRVYSRVGSYWKGLVLAVLLMAGAAATQPTLAVIMKPLLDDGFSg-----------------------------AKPH 69
gi 17429219   19 HFKRLWAYLRPELSSFILAMVAMGVVAATEGIIPKVVKDLLDQGFGg-----------------------------EYAG 69
gi 488175882  17 SFMRLMAYVRPYKIRIVAALIAIFGVAATESYLAAFIAPLINHGFSapaappelsaaagilstlqnwreqftymvWGTEN 96
gi 24986705   16 IYFRLLSYVKPYVGIFLLSIVGFVIFASTQPMLAGILKYFVDGLSNpeavlf------------------pnvpyLRDLQ 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A        63 VLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQSTGTLLSRITYDSEQVASSSSGA 142
gi 127339     63 VLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQSTGTLLSRITYDSEQVASSSSGA 142
gi 28056348   67 VALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTKYFRLPGSRFDGEPVASMLVRLGSDSEQVAHAVIDA 146
gi 33576803   70 YVWFLPLAVVGLILLRGICNFFSDYLLAWVANNVLRGIRGEMFERLLGLPDADFKRGDTGRLLNRFTIDAGNVTGYATDV 149
gi 17429219   70 KLWRVPAMLVGIAVVRGVAQFGATYFLSLVSNKVLLNLRMKMFERLLQAPAAFYQRNTAASLINAVIFEVNQVLQVLTGV 149
gi 488175882  97 KIWTVPLFLIILVVIRGICRFTSTYLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNMLNLTEQSVSNASDI 176
gi 24986705   78 LLQAVPLLIILIAAWQGLGSFLGNYFLAKVSLSLVHDLRVALFNKLLVLPNRYFDNHNSGHLISRITFNVTMVTGAATDA 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A       143 LITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGG 222
gi 127339    143 LITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGG 222
gi 28056348  147 MKVMVQQTLQVIGALVVMLWYSWTVTLAILLVAPLLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAA 226
gi 33576803  150 ITVLVRETLVVIALIGVLLYMSWALTLIILVMLPVSVGIARAFTRRLRRINRETVNMNAELTRVVSEGIDGQRVIKLFDG 229
gi 17429219  150 FITLVRDSMTVLALLIFLFYTNWRLTLVVAVILPVIGFLMSRINRRLRSLNREHQNLTNEAAYVVEEAAGGYKVVKLHGG 229
gi 488175882 177 FTVLTRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDRLKHVISDSQKSIGTMNNVIAETHQGHRVVKLFNG 256
gi 24986705  158 IKVVIREGLTVVFLFAYLLWMNWHLTLVMVAILPVIAVMVSIASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGG 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A       223 QEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSltAGTITVVFSSMIALMRPLKSLT 302
gi 127339    223 QEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSltAGTITVVFSSMIALMRPLKSLT 302
gi 28056348  227 QESELERYARLANINLGLAVKVESTRSISSAAVQLLGAVGLAMLLLIAGHEALAGRlsPGDFVSLMTSMIAVIPALKQLT 306
gi 33576803  230 YDAERRRFDFVNSRLRRFAMRSATADAALTPLTQVCISVAVGAVIAVALSQANSGAltVGSFASFMAALAQIFDPIKRLT 309
gi 17429219  230 EAYESRRFNAMTNRLRGYAMRMAVAGGLNQPVTQFLAALALSVILAIAMVQAQANQttVGGFTGFVMAMLLLISPLKHLT 309
gi 488175882 257 QAQAANRFDAINRTIVRLSKKITQATAAHSPFSELIASIALAVVIFIALWQSQNGYttIGEFMAFIVAMLQMYAPIKSLA 336
gi 24986705  238 EAYEQQRFGQASQSNTDKQLRMTKTGSLYTPMLQLVIYSAMAALMFLVLFLRGDST--AGDLVAYITAAGLLPKPIRQLS 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A       303 NVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIER-ATGDVEFRNVTFTYPGRDVPALRNINLKIPAGKTVALVGRSGSG 381
gi 127339    303 NVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIER-ATGDVEFRNVTFTYPGRDVPALRNINLKIPAGKTVALVGRSGSG 381
gi 28056348  307 NVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGR-ARGLIEFRGITARYPGRSAPVLDSVSFVAAPGTVTAIVGRSGSG 385
gi 33576803  310 NLAGKMQKMLVAAESVFTLVDQTPEADAGTRALPEpVRGKVEFRAVSHRFPDADRDTVSAVSFLVEPGQTVALVGRSGSG 389
gi 17429219  310 DVNQPMQRGLTAAEFIFGLIDTPIEPQDGGKHIDR-ARGDLRFEHVTFRYGPDGRAALDSIDLHVKAGEIVALVGPSGSG 388
gi 488175882 337 NISIPMQTMFLAADGVCAFLDTPPEQDKGTLAPQR-VEGRISFRNVDVEYRSDGIKALDGFNLDIRQGERVALVGRSGSG 415
gi 24986705  316 EVSSTIQKGLAGAESIFEQLDEAPEVDTGTVEKER-VEGRLEVRNLSFTYPGTEREVLSDISFVAEPGQMIALVGRSGSG 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A       382 KSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTe--QYSREQIEEAARMAYA 459
gi 127339    382 KSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTe--QYSREQIEEAARMAYA 459
gi 28056348  386 KSSLIKLIPRFYEPESGQILLDGHPLQDYLLADLRRQIALVGQQVMLFDGSIADNIAYGEMr--QVVSEEIERVVVDANA 463
gi 33576803  390 KTTLVNMLPRFVLPDGGDILFDDVPIQDLTLRSLRSHLSLVSQDVVLFDDTIAANVGYGAGg--TVDDARVRDALAAANL 467
gi 17429219  389 KTTLVNLLPRFFEPTSGRIVLDGDALADLSLQDLRRQIAFVSQDVVLFNDTIAANVAYGARdasEIDMARVRRALEAAYL 468
gi 488175882 416 KSTVVNLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQDVFLFDDTLFENVRYSRP---DAGEAEVLSALQAANL 492
gi 24986705  395 KSTLAALIPRFYHHDKGQILLDGVEIEHYRLRNLRRHVSQVTQHVTLFNDTVANNIAYGDLa--GAPRADIEAAAADAYA 472
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3B5W_A       460 MDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRL 539
gi 127339    460 MDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRL 539
gi 28056348  464 QDFVNQLPEGLQFQVGVKGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALQRLMPERTTLVIAHRL 543
gi 33576803  468 LEFVDGLPLGIHTPVGQNAARLSGGQRQRLAIARALIKNAPVLILDEATSALDNESERQVQASLERLMRGRTTLVIAHRL 547
gi 17429219  469 TDVVDNLPDGVDTNIGDNGSKLSGGQRQRLAIARAVYKDAPILILDEATSALDSESERQVQAALEALMQGRTTLVIAHRL 548
gi 488175882 493 QSLIDASPLGLHQPIGSNGSNLSGGQRQRVAIARAILKDAPILLLDEATSALDNESERLVQQALERLMENRTGIIVAHRL 572
gi 24986705  473 KEFVDRLPKGFDTEVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMQGRTTLVIAHRL 552
                        570       580       590       600
                 ....*....|....*....|....*....|....*....|...
3B5W_A       540 STIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ 582
gi 127339    540 STIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ 582
gi 28056348  544 STIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQFRE 586
gi 33576803  548 STVQNADRIIVLDAGKIVEHGPHSELLAANGLYASLYNMQFRE 590
gi 17429219  549 STIENADRIVVLEHGQIVEAGTHRELLDRDGLYAGLHRIQFAT 591
gi 488175882 573 TTIEGADRIIVMDDGKIIEQGTHEQLMSQNGYYTMLRNISNKD 615
gi 24986705  553 STIEKADQILVMDQGRLVERGTHTELLAANGHYARLHAMGLDE 595
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap