Conserved Protein Domain Family
MsbA_rel

?
TIGR02204: MsbA_rel 
ABC transporter, permease/ATP-binding protein
This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Statistics
?
PSSM-Id: 131259
View PSSM: TIGR02204
Aligned: 8 rows
Threshold Bit Score: 856.692
Threshold Setting Gi: 15075799
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799   12 RSIRPLATVLPYLSRYRGLAIGAAVSLTIAAATTLTLPLAVRRMIDHGFSNSDSGFINTYFSMLMVLAVVLALASAARYY 91
gi 27349760   49 AKLRPLLALAPYVARYRGRAALAFVALTIAALTTLLVPVAVRRMIDFGLTPEGIELINSYFSVMIAVVAVLALASAARYY 128
gi 13424964   36 KDIRPLAHLLPFVIAHKGDGLAAGFFLLFSTAATLGLTYAFKNVIDHGFSKGQDAAINSAFVGLGAVALVLALATALRFF 115
gi 40063615   18 KRIGALAALWPFVRPYRVMMGFAIVALVATATVSLVLPLAVRKVVDN-FNADESNLLDQYFAMAIVVVALLAFGTGMRYA 96
gi 28057949   49 QRLNHLRILWPFMRRHLALFSGWLIALAVSSAATLTLPSAFKQMIDHGFSSE--GQINRSFALLLLVAVILAVGTAARLF 126
gi 27358201    7 KNLGILLKLSTFVSPYRWRVAAALVALVATASLTLSVGYGVRMLIDQGFAQQSLHELTNAIQFIVGVTLCIAIGTFFRFY 86
gi 24349940   11 SQRAVLPWIWQFLKPYRPRVVAAIVFLLIGSLAWLSLGQGVRLMVDEGFIKDNAQRLNEIILFVLVITAVSGTAVFCRFY 90
gi 489203403   8 RQRIALRLAWRFMAPYRWRMLGALVALLFTAAITLSLGQGIRLLVDQGFLTASPELLNRYILLFFVLVLGLAVGTFVRFY 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799   92 FVISLGERIVADLRRDVFARVMQLSASFFDVNQSGEIVSRLTADATQIKSAVGATASVALRNLILCLGAMGMMVYTSPKL 171
gi 27349760  129 LVMTIGERIVADLRRDVFAHLLSLSPAFFDSARSGELISRLTADTTQLKSAVGASVSIALRNLMMFFGAVAMMVITSPKL 208
gi 13424964  116 FITRLGERVVADLRRKLYGHTLSLDQPYFLKTRTGEVLSRLTTDVALVEQLVGASISIALRNILNLIGGLTAMAVVSPKL 195
gi 40063615   97 LVTRLGERVVTDIRKAVFGRVINMSPAFYDNILTGEVLSRITTDTTLILSVIGASVSIALRNMLIFAGGLTMLLLTSVKL 176
gi 28057949  127 SVSLLGEKIITDLRSQLYAHLIGLDASFHDRNRSNELVSRLATDSELLRSIIGSTMSVATRSTVTAIGSLIMLFITSPRL 206
gi 27358201   87 LVSSVGERVSADIRLAVFNHVITLHPSYFETNSSGDIMSRLTTDTTLLQSIIGSSFSMAMRSALMCVGAIIMLFATNFKL 166
gi 24349940   91 LMTWLGERVSADIRLAVYNQLLKLSPAFYAKVRTGEVISRFTADSTLLQTVVGSSLSMALRSGVTVIGGLAMMGITSVKM 170
gi 489203403  88 LVSWIGERFVADIRKRVFDHLIELHPGFYETNRSSEIQSRLTADTTLLQTVIGSSLSMALRNALMLVGGVLLMFVTNAKL 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799  172 SSLVLAAIPLIVFPLVGFGRSVRRRSREAQDMLAAASAYAGEAIAATRTVQAFNGEESARSRYGSAVEAAYRAARAATRA 251
gi 27349760  209 SGFVLLAIPLIVLPLVAFGRWVRRLSRNAQDTLAEASAYAGELVGAIRTVQAYTSEGLAAKRFGGEVEQAYEAARTSTQA 288
gi 13424964  196 AGFIVLMVPVILAPMFLVGRRVRKLTVTAQDRFADAVGYAGESLDALETVQAFGRESASSGRFGAAVEAAYKASVRRITT 275
gi 40063615  177 TGLLLLIVPIVALPVLTLGRRLRVLSRENQDFIAASSGNASEVLSALQTVQAFTHETASRQTFDRVTEKSFEVAAQRINT 256
gi 28057949  207 ASLSLVVIPFVILPIFLGAQHLQKAARTSQDRIADTNSFAAETLRALRTVQAYAREHYERTRFDRALETSLQAARQRIHI 286
gi 27358201  167 TLIVLASVPFVLVPILVYGRRVRALSRQSQDSMADVGSYAGEAIEHIKTVQSFSSEQHEKAAFAVEVEKAYEIGRQRVKQ 246
gi 24349940  171 TLLVLLAVPLVLGPVSFFGRKVRTLARESQDRVADLGAYVDETLHEIHTVQAYGHEDKDRSLFNGRVEDVMTAASGRIRY 250
gi 489203403 168 TSIVVLALPLVIAPILLFGRRVRSLSRESQDRVADVGSYVGETLGQIKTVQAYNHQAQDRQRFAGTVERAFDTARKRIAQ 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799  252 RSVLTAFAITMVFGSVVAVLWFGARDVLADSLSAGTLGQFLLYSVFAAGSLGALSEVWGELSQAAGAAERLNELLNEVPE 331
gi 27349760  289 RAVLTAIIIFIVFASVVAILWIGSHDVLTGAISPGRLGQFVLYAAFAAAGLGQLSEVWGEVSAASGAAERLFEILHVQPD 368
gi 13424964  276 RATMTAMVITLAFGGITLLLWTGARLVLAGEMTGGTLAQFAMLAVMAAGSIGALGEVWGDVQKASGAMDRISELLNAKPD 355
gi 40063615  257 RVLMTMIVIYMIFSGVVGVLWIGVHDIRSNAISAGELAQFVIYAILVAGSASALSEIWGELQRAAGATERLVELLQAQDT 336
gi 28057949  287 QTWVTAASIVLIFSAIVGVLWAGAHDVIAGRMSAGTLGEFVLYALISGGSIGSLAEVWNELQRAAGGMGRIFELLKEKNT 366
gi 27358201  247 RAILISGVIVIVFGAIAGMLWVGGSDVIHGKMSAGDLGAFVFYAIMVASSTATISEVLGELQRAAGATERLIEILQVESD 326
gi 24349940  251 RALLISSVMFLSIAAIALVTWVGAHDVMSGKMTGGELSAFMFYAVMVAGAVATISEVVGEIQRASGAAERLIELAETEVD 330
gi 489203403 248 RAWLITVVIVLVLGAVGIMLWVGGRDVIAGSISAGELAAFVFYSLIVGMAFGTLSEVIGELQRAAGAAERIAELLRARSE 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799  332 IEAPEHPVAMPVPATGAVEFENVHFAYPARPDYKSLRGLSFAVRPGETVAIVGPSGAGKSTVFSMLLRYYDPAKGTIRVD 411
gi 27349760  369 IKAPASPRALPVPARGEVGFDQVSFAYPARLDVKVLDAVSFTVRPGEKVAIVGPSGAGKSTIFHLLLRFYDPRSGAISLD 448
gi 13424964  356 IAAPPQPKTLPVPGQGEIAFENVVFAYPGRPDLPALNGFDLRVKPGETVALVGPSGAGKSTVLRLLLRFYDPQSGCILLD 435
gi 40063615  337 VTEPKNPLDLSQPLRGEIIFDDVHFRYPARPDRLSLSQINLTINPGETVALVGPSGAGKTTIIQLILRFYDPTSGQVRLD 416
gi 28057949  367 LSVPATPTLPPHPLRGEIRFERVGFHYPQRPETPALDGIDLHIRPGETIAFVGPSGAGKSTLLSLLLRFYDPTHGRILID 446
gi 27358201  327 IKAPSHQQSIPADIPAEVSFDSVNFNYPSRPNQPAIKGLNLTAEQGKVLALVGPSGAGKTTLFELLQRFYDPQQGHVLLG 406
gi 24349940  331 IPAPLVPKTLPTKVRGELQLHQLNFHYPEQT-QLVLSDLNLVINAGERVALVGPSGAGKSTLFQLLQRFYVPSSGSILLD 409
gi 489203403 328 IRPPAQPRKLAARVSGRIELQAVRFAYPTRPEHWAIDDISLAVEPGETLALVGPSGAGKSTLFDLLLRFFDPQQGRLLLD 407
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799  412 GTDVRAVDPEELRERLAIVPQDVTIFATSVHDNIAFGVPDASREAVRAAAVAAQADEFIGRLDRGYDTLVGERGVTLSGG 491
gi 27349760  449 GVPVRSADPRDFRSRIALVPQESNVFAASARENIRFGRPDATDAEVERAAELAHAAEFVRRLPEGFDTPLGERGVTLSGG 528
gi 13424964  436 GVNLRDAEPAEVRARMALVAQDSPLFSGSAMDNIRFGRPDATDEQVRAAADAAQATGFLSALPEGFDTPVGERAKTLSGG 515
gi 40063615  417 GVNLCDLRRDVFRNVVALVPQDPVVFAASALENIRFGNPEASDEQVYAAARAAVAHEFITQLPDGYDSYLGERGVMLSGG 496
gi 28057949  447 GVDLRQTDPKVLRTHIALVQQQPTLFTASAMENIRYGRLDATTAEIEIAARSSEADGFIRALPQGYATELGEHGLSLSGG 526
gi 27358201  407 GIDIRQFDPNELRQQMALVPQQPALFSHDVFHNIRYGNPDATDEQVIEAAKKAHAHEFIEKLPEGYHSFLGERGVRLSGG 486
gi 24349940  410 GIDIAALSPQDLRAQFALVPQDSVIFATSVLENVRYGRVDASEQEVIDACIAARAHEFISEFSEGYQTYLGERGVRLSGG 489
gi 489203403 408 GQPIVELDPADLRRSFALVSQNPALFFGSVEENIRYGRPHASAAEVEAAARAAHAHEFILGLPQGYATHLGEGGIGLSGG 487
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15075799  492 QRQRIAIARAILKNAPILLLDEATSALDAESETLVQKALDVLMQERTTLVIAHRLATVLKADRILVMEHGRIVEEGTHES 571
gi 27349760  529 QRQRIAIARAILRDAPLLLLDEATSALDAESETLVQTALEELMKHRTTLVIAHRLATVLSCDRILVMDQGKIVEQGTHAE 608
gi 13424964  516 QRQRLAIARALVREAPILLLDEATSALDAESEQLVQQALATAMEGRTTLVIAHRLATVLKADRIVVMEEGRVVEQGAHAE 595
gi 40063615  497 QKQRIAIARAILRDAPVLLLDEATSALDAESEQAVKLAVETLSSDRTTIIIAHRLATVKKADRIVVMDKGQIVDTGTHDE 576
gi 28057949  527 QQQRIAIARALLKEAPILLLDEATNALDAQNEQAVQQALERLMTGRTTLIIAHRLVTILKADRIVVMDQGRIVAQGTHSE 606
gi 27358201  487 QKQRIAIARAILKDPKILLLDEATSALDSESEHHVQQALEALMKGRTTLIIAHRLSTIQHADKIAVLDNGELVDIGNHHA 566
gi 24349940  490 QKQRIAIARAILADRPILLLDEATSALDALSEQKVKQALDELMAGKTTLIIAHRLATVINADRIIVFDKGRIVASGKHQD 569
gi 489203403 488 QRQRLAIARALLVDAPVLLLDEATSALDAESEHLIQQALPGLMSGRTTLVIAHRLATVQSADRIAVIDQGRLVAIGSHAR 567
                        570
                 ....*....|....*.
gi 15075799  572 LIRQGGLYAKLARLQF 587
gi 27349760  609 LVAANGLYARLARLQF 624
gi 13424964  596 LFAKGGLYARLARLQF 611
gi 40063615  577 LVAKGGLYAHLARLQF 592
gi 28057949  607 LIAAGGLYAKLARLQF 622
gi 27358201  567 LMQSCELYQRLVALQF 582
gi 24349940  570 LIKTNALYREFATLQL 585
gi 489203403 568 LIAENPLYARLAELQF 583
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap