Conserved Protein Domain Family
intg_mem_TP0381

?
TIGR02206: intg_mem_TP0381 
conserved hypothetical integral membrane protein TIGR02206
This model represents a family of hydrophobic proteins with seven predicted transmembrane alpha helices. Members are found in Bacillus subtilis (ywaF), TP0381 from Treponema pallidum (TP0381), Streptococcus pyogenes, Rhodococcus erythropolis, etc.
Statistics
?
PSSM-Id: 131261
View PSSM: TIGR02206
Aligned: 9 rows
Threshold Bit Score: 164.017
Threshold Setting Gi: 19748576
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 141438    12 DPFHLFSTEHVVTLAIISLLAILLFLFQDEVKQPRASRFLRslfVFLLLGSQIGYQIWMVATDRWSVRTSLPLQLSDLSV 91
gi 30254391  11 KPFIPYSRQHAIILFIMLVGIVFLYQYQDVLRQNEWNITVRyaiAILFIGSEIGLHMWEWKAGIFELATSLPFELCTISL 90
gi 19714575   3 DKFVLFSNQHFITMGIGFFSCILLVFLGFFTEKKVAFAKII---AIIVLGVKIAELSFRYYYYGETVAQLLPLHLCPIVI 79
gi 37912863   2 SPFNLLSPSHIIVCIMCFVAIVYIPKYFKNSTDTAKLLLSY---SIIFLMLINQGMDFYREGYLDEWKLGLPLHLCDFAS 78
gi 18144488  19 YTFPLFSSLHFKIILCVVITIFIAIIFKEKIKKWKYRRAFEittALILISTQIFLAIWYSRFPNFYLKESLPLYPCRIAI 98
gi 14285873  10 GLFVRFGALHFAIASVAVLLSALFVLLPFALPRLLAHKNLAr-aGVAILFLRLGLMLCGTLLDGRSWRNELPFHLCPAAL 88
gi 19748576   6 IDPIGLPHTSLIFYLSSLLIALLLVFLTFQAYRLKSYRYFF---LFLQLSQVIGLYTWYVLRG-FPLDEALPLYHCRIAM 81
gi 33668983  21 PEFSAYGLSHWAVIALFVVGSVFLIFAGRRQTEVQARHLSR---VLGGILAVIYGSAVLYSLSSPTLGGSVPLQLTDLAT 97
gi 41325309   8 GAMPQYGFEHISMLITAVVLAILVVPIARRFNFAPAFGWVL------LI-ATLLSNLWNFMPGYYTLDQSWPFHFSDALR 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 141438    92 YLSAIMLVTKSR-KLFVFLFFVGIGSSIQALATPDLgMFSFPHIRYILFFISHGSVFLSCLLMAVIGTYRMGQRSLWVTV 170
gi 30254391  91 LLASIMIVTKSY-RIYEIVFFTGIIGASQAILTPNL-QYAFPHFRFIEYFIAHILLIWAPLFMTWVEGYRPTVQSIKRTM 168
gi 19714575  80 ILSIFMMFFHSE-ILFQPVYFWSIG-AFFAILMPDIr-DGMSNFASQSFFITHFFILFSTVYAFVHFRFRPTKSGFIYSF 156
gi 37912863  79 LAGALYLITKKR-EFFLFAFFFGIAGGTMSILTPDV-IYGFPHVPYIQNEIGHLLIILSVSYGIIIDNQRPYLKDCHRVL 156
gi 18144488  99 IMAAIGLIWKKNdFAKSIAYFWGTIGAIGALMIPITnSYIFPHITYYTFFIGHYFLLIASLYLILIEEFKVKSKNVKQAL 178
gi 14285873  89 ISGSLYFITRRP-IFFNLLYFWHFG-SFVAVLYPDLt-RAHTILYAYLFMLTHCLEPAMVVFSLLHLRERISKRGLQCAV 165
gi 19748576  82 LA--IFFLPDRN-KFKQLFMVLGIGGTFLALLSPDLyPFRLWHVANVSFYLGHYALLVNGLIYLLRFYDASQLRLLSVVR 158
gi 33668983  98 VSAIYALWSHRH-WPFALTYYWGLVLSTQALISPALaGPDFPGYEFLVFWAIHLFVVWAAIYLTWGRRMRPTWRSYRLAV 176
gi 41325309  81 IIAAIALINRAR-WAVSVTILWGTTINLMSLLTPDVqYLQVPWLEFLMYWFMHISVFLAAIILIFAFGEKPGLSGVVMSV 159
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 141438   171 LLVNVYGVCIFLIDRWLG--ANYMYLTKKPGGSSLLDVLGPWPWYIVS---AEAITIASFFILYWLYRIFK 236
gi 30254391 169 IFLNILIPIVSFVNYKTG--GNYMFLAHKPETASLLDMLGPHPYYIIS---LELAALIGCFILYMPFAKRE 234
gi 19714575 157 LMLVILAFIMYFINNRLG--TNYLYVNHPPVTKSLVDFMGPWPYYIFS---LAGIDIAISFFMYLPFRRNK 222
gi 37912863 157 IFASFLLAIMYLVNYLLGppANYWYLAEKPIGDNITSFMRPEPFHVID---LYALAVILVYLMYLPYYLKD 224
gi 18144488 179 IFSFIFAICAFIANYLFD--ANYAFLN-PPNGYEILNIINVESNIITTsifAYFIFVLGIFIMYLPFNMSD 246
gi 14285873 166 LGFLLLAANALFWNRRLG--ANYLFISKYP--LEILRVIRPFFVYQLL---FVSALCLLMLVLYLPFRPSQ 229
gi 19748576 159 YLATVNFLLLLVSLATKG---NYGFVMDIPVIHTRHLLLN--FVIVTS---GLTFMVKITEYFYLKFGEAQ 221
gi 33668983 177 LVTLTWAIVTFIFNRVAD--TNYGFLNAKPSTASLLDLMGPWPVYLFS---GMTIVFVIWALMTWPWERDG 242
gi 41325309 160 AVAISWGIMCLMVNAFLG--TNYGYLSTEPESASILDLLGGWPFYIVA---EVLLLCAVWALWSYLIDKLP 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap