Conserved Protein Domain Family
ftsL_broad

?
TIGR02209: ftsL_broad 
cell division protein FtsL
This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 131264
View PSSM: TIGR02209
Aligned: 20 rows
Threshold Bit Score: 57.6604
Threshold Setting Gi: 33322319
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30138604    1 MIKLNIFLFMVLVICGLGIVTARYESRKLFMEQEEAQQLTEQLETEWNQLRLEQTTLAMPARVEKIARKELgmTMPPPAA 80
gi 33517272   19 YGKVRLLLLLFIMVSAMLVIIVTHQTRCMIMEQDKFLLEVNMLDHEWSNLILEKKKLSNHIRVESIAIQKL--QMRYTDP 96
gi 25166168   18 FSKLSIFITILILITSVLTIYITYKTRYFINEREKIFLENDFLEHEWNNLILEKYVLGNNNRIGSLAKKNF--NMNYIDY 95
gi 1169758    22 SNKLVVLLLIGILVSAMGTIWITHKTRQLISENGMLILQRQALENEYRNLQVQEATEGDSTRVESIAISTL--KMKVVSS 99
gi 33568810    1 MGRTSLIVAALLMLSAISLVTSRYQSRQLFIELGRSQAEARDLDTNWRRLQLERAELARNARIDRAARDDL--KMIPIVP 78
gi 17429874    1 MNRLNMFLLTALVLCALSLVNAQHQARQLFVELDRAQAEEKQLNIDWSRLQYEQSSLGKSARIAEIARTQL--KMAPAQA 78
gi 29540737   25 QGVVIVALVIALLCSAFGVVYFKDLNRRLFIQYQTLQREKAEELIQWGKLLLEQTTWSTQSRVQRIAEQQL--GMQLPSA 102
gi 28854801   12 GSFIMLLLFIAVLVSAIGVSYSAHWNRQLLNSLYSEMSVRDKAQAEWGRLILEQSTWTAHSRIETLATEQL--KMRIPSA 89
gi 300420589  35 FGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKL--QMQHVDP 112
gi 488149155   1 MNKLNFLLLLAVCVSAFSVVMQQNQYRLNFTALDKAKKQEIALEQDYAQMRLQQARLANHEAIRAAAEKQ---NLHPPVS 77

                 ....*..
gi 30138604   81 GNILAIH 87
gi 33517272   97 ILDNMYK 103
gi 25166168   96 SKENIII 102
gi 1169758   100 EQEVEIR 106
gi 33568810   79 DRTLYMN 85
gi 17429874   79 GRTQYLQ 85
gi 29540737  103 KEVILVN 109
gi 28854801   90 AEVRMVA 96
gi 300420589 113 SQENIVv 119
gi 488149155  78 GNTFMVE 84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap