Conserved Protein Domain Family
LolD_lipo_ex

?
TIGR02211: LolD_lipo_ex 
lipoprotein releasing system, ATP-binding protein
This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131266
View PSSM: TIGR02211
Aligned: 9 rows
Threshold Bit Score: 356.662
Threshold Setting Gi: 25166056
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134819     6 ILQCINLTKSFYRKKEEIRTLNKISLKIRKGDITFITGKSGSGKSTLLHLLGGLDKPTSGSILFDGVSLHSMSSNEIAKL 85
gi 11133483    5 IIKCINLNKSYKDGDFTYTILKNISFQLNKGDIAGIIGKSGSGKTTFLHLLAGLENPTSGDILFNGRLFSSMSSNKMSKF 84
gi 25166056    6 LLKCKNVTKTYKTNKKKIIILNNINLSIYNSETISIIGDSGSGKSTLLYLLSGLDNPTTGKITFKGKEINKLSSSDRSYL 85
gi 34104272    4 VLSCRSLGKRYQEGKLALDVLSGVDLEVGKGEHLAIVGASGSGKSTLLHLLGGLDTPTAGTVEVLGRDLSKLSETERGKL 83
gi 122065411  14 VIRAERLGKTYSEGKLLTQVFDGLDLQVMRGETVAIVGASGAGKSTLLHLLGGLDVPTAGEVYVAGQRMSALSDGDRGRL 93
gi 9910768     5 ILKCEGVGKRYRDGGLDVRVLHGLDLEIHAGESTGIIGSSGSGKSTLLHILGGLDMPSEGRVLLMGEDLRTLNQRRLGDL 84
gi 1175552     5 LLKCENINKFYQEGENQTQVLKGVSFSMEPAELVAIVGSSGSGKSTLLHTLGGLDQPSSGEVFINGQSLQKASANELAAL 84
gi 38502971    4 LLECRDIRKVYREGSLDTEVLKGVSFDIDKGELVSIVGSSGSGKSTLLHILGALDDATQGEVDFLGQNLSALSSNKQAAL 83
gi 3915974     5 LLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAEL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134819    86 RNLKLGFIFQFHHLLLDFNVLENIAIPSLISKKSIQESKEKSYEILKKVHLEKKINKYPSELSGGERQRVAIARALVNQP 165
gi 11133483   85 RNIELGFIYQFHHLMLDFNILENVSMPLLISNKSKKDSEEIAYNMLKKFNLEDKIKKYPSELSGGERQRVAVARAFINKP 164
gi 25166056   86 RNKNFGFIYQFHHLLTDFSVLENVAMPALIGNFSVKHAKNLAYKLLLEVGLKNRINHKPSEISGGERQRAAIARSLINNP 165
gi 34104272   84 RNESMGFVYQFHHLLPEFTALENVMMPLLIRRMDKGEAARRAAEMLERVGLGKRLEHKPGELSGGERQRAAIARALVTQP 163
gi 122065411  94 RNKTLGFIYQFHHLLPEFTALENVMMPVLLSGQSVCSGQMRAQMLLEAVELGHRLNYKPSELSGGERQRAAVARALANSP 173
gi 9910768    85 RNRHLGFVYQFHHLLPEFSALENVMMPLLIGKKSREEAAEAAMAMLEKVGLKHRSTHRAGELSGGERQRAAIARALVTQP 164
gi 1175552    85 RNRYLGFVYQFHHLMADFTALENVMMPMLIGHQNKTEAKDRAEKMLSAVGLSHRITHRPSALSGGERQRVAIARALVNNP 164
gi 38502971   84 RNKHLGFVYQFHHLLADFTALENVAMPLLIGGIKVTEAKQAAKALLEKVGLSHRMDHRPSELSGGERQRVAIARALVNKP 163
gi 3915974    85 RNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNP 164
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 8134819   166 SLVIADEPTSHLDKNNAKIIFDLIFELNSNLNTSFLIVSHDLRFIKKAPILLEMKNGQLFN 226
gi 11133483  165 SLIIADEPTGNLDEDNTNIIFNLITELNSDYNTSFIIATHDPTLIKKIPVLFKIENNQIFN 225
gi 25166056  166 KIVFADEPTGNLDNTSSKKFFCLLKKVNVEKKTAFLVVTHNIKLAKKLDKTLEIKNGKLYK 226
gi 34104272  164 ACLLADEPTGNLDAHTASQVFELMLELNRTLGTSLIIVTHDLELAGRTQRVLRLNEGRLAV 224
gi 122065411 174 DCVLGDEPTGNLDNRTASTVFELMLELNRAQRTSLVLVTHDRGLARCLDRVLELYQGGLRE 234
gi 9910768   165 KCLLADEPTGNLDRANARNVLDMMLELKTELGTGLVVVTHDDELAGRFERVMVMKDGSLHP 225
gi 1175552   165 SLVLADEPTGNLDHKTTESIFELIQQLNQEQNIAFLLVTHDMGLAEKLSRRLVMQDGLLKE 225
gi 38502971  164 DLVLADEPTGNLDHNTALAIYDLMRELNKESNIAFLVVTHDNELAAKMDRQMHMQDGLLVD 224
gi 3915974   165 RLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTA 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap