Conserved Protein Domain Family
lolE_release

?
TIGR02213: lolE_release 
lipoprotein releasing system, transmembrane protein LolE
This protein is part of an unusual ABC transporter complex that releases lipoproteins from the periplasmic side of the bacterial inner membrane, rather than transport any substrate across the inner membrane. In some species, the permease-like transmembrane protein is represented by two paralogs, LolC and LolE, both in the LolCDE complex. This family consists of LolE, as found in E. coli and related species. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131268
View PSSM: TIGR02213
Aligned: 3 rows
Threshold Bit Score: 683.106
Threshold Setting Gi: 27361562
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27361562   4 SLALLIGRRFSQAKQRNKMVSFISLSSTIGIAVGVAVIIIGLSAMNGFERELQSRVLSVIPHAELEGVR----APVENWQ 79
gi 12230915   4 PLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVD----QPWTNWQ 79
gi 1175890    2 NTPFFISWRYQRGKQKNPLVALIAKFSAIGIALGVAVLIVGLSAMNGFERELNQRILAVVPHAEILSAPnatePTIHHWQ 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27361562  80 SVMTQAVANPKVVAAAPYVKFTGLVERGNKLKAVEVRGVEPDFEQAVSTMSQFIDQQAWSQFLPGQNQVIVGRGVANELG 159
gi 12230915  80 EALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALK 159
gi 1175890   82 NLEKRLQQNPQIKGISPFVSFTALVENGSKLKVVQVKGVEKQAEDKVSSIGNFVQEQGWNKFEK-EGGLVLGSGIAKELD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27361562 160 VDVGDYVTLLIPQTGESTKVQAPKRVRVKVTGMLTLNGQIDHNLVLLPMADAQQYNHLG-EGVTGIALKTNDVLNAQAIV 238
gi 12230915 160 VKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMG-SSVSGIALKMTDVFNANKLV 238
gi 1175890  161 VKVGDWITLLISQQNGDEQFAQPTREPVQVTSILRLDGQLDYSYALLPLAQAQTFLTYQpDQITGVELKLDDPFSARNLD 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27361562 239 REVGRQIDVYVYLRSWQQQFGFLYRDIQLVRTIMYLVMVLVIGVACFNIVSTLMMAVKDRASEIAILRTMGAGDGLIKRI 318
gi 12230915 239 RDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAI 318
gi 1175890  241 LSMLNDYPQMLYMQNWISKFGYMYRDIQLIRTVMYIAMVLVIGVACFNIVSTLIMAVKDKQGDIAIMRTLGANNAFIKRI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27361562 319 FVWQGVFSGVLGSVLGSVVGVLVALNLTTLIKGLERVIGHQFLSGDIYFVDFLPSQLRVDDVLLVSGTAIVLSIVATWYP 398
gi 12230915 319 FVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYP 398
gi 1175890  321 FIWYGLQAGMKGCLIGIVLGIILALNLTTFIQGIEWVIGKKLLSGDVYFVDFLPSELHWLDVLMVLVAALALSLMASLYP 400
                       410
                ....*....|....*.
gi 27361562 399 AARAAKLKPAAVLSSK 414
gi 12230915 399 ARRASNIDPARVLSGQ 414
gi 1175890  401 ASRAAKLQPAQVLSSH 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap