Conserved Protein Domain Family
spoVD_pbp

?
TIGR02214: spoVD_pbp 
stage V sporulation protein D
This model describes the spoVD subfamily of homologs of the cell division protein FtsI, a penicillin binding protein. This subfamily is restricted to Bacillus subtilis and related Gram-positive species with known or suspected endospore formation capability. In these species, the functional equivalent of FtsI is desginated PBP-2B, a paralog of spoVD. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131269
View PSSM: TIGR02214
Aligned: 4 rows
Threshold Bit Score: 1047.48
Threshold Setting Gi: 18145544
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936   11 RLIFILISGILIFTIIDiRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRNGVELATNKSAPTVFVVPRQIEKPA 90
gi 27262270   11 RSTHILISFTALVCILIlRLFWVQVVNGSFYAEKAEDVRMRELPVEAKRGTIFDRNMNSMAVSVSVDSVVANPAEVRKNK 90
gi 18145544   16 RVLAFLLAIVILFLALSgRLLYISIFRSKDYKAMAEEQWTNEIQIDARRGRILDRNNRELAVTANVFRVDLDLITLRKYI 95
gi 499268036  16 IFIVFLILTCVIFLLCY-KLFNVMVARSSRYKKMAQEQWTSEVKISAKRGRILDRNGEELAISGNVYRVDLDLNTIKNSL 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936   91 ET--------AEKLAAVLGVEKDEIYKRITKKE---SIVRLDKggRKISHDKAKEVRG--LSLKGVYIAEDSIRYYPFGN 157
gi 27262270   91 EPeqr---aiANELARVLEMDPEKVFQTITKAN---SGFVWVK--RKVEPDKIEQLRNstVKLNGISFIPESKRFYEKGK 162
gi 18145544   96 DKkdtdnieiAKLLAEALEMDEEKVLSRIELTYpsgNPANSATliRRIEKEKADKVKE--LDINGVIVSEDTKRYYPNGD 173
gi 499268036  95 AEkkmkmdelADRLSSALDMDKKDVSKQLNKKFkdgRPMGSAIltRRIDKDKANKVLA--INVKGVMVSPDTKRYYPNSD 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936  158 FLSHVLGFAGSDNQGLMGLEKYYDKELNGDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIA 237
gi 27262270  163 LAAHILGFTDTDARGIEGLELIFDKELRGLPGKLVAEYDARNLELPQAQHAYVRPVDGHSLVLTIDETVQYIIERELDKL 242
gi 18145544  174 FLSHTLGTTNADGEGLSGLELYYNEELMGIPGVRVSEVSGNSTSNPYSETSFTPPVDGKDMTLTIDENIQYFVEKVAEDA 253
gi 499268036 173 FLSQVIGHTNSDGDGLTGVELKYNKYLKGKPGVRKAEIDKNSANLPYTISEYSKPLDGRDVVLTIDKNMQYFAEKYAQEA 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936  238 ESTYNPDGMIAIAMNPKNGEILGMSSRPSFDPADfQSVSPEVYn-----------RNLPVWSTYEPGSTFKIITLAAALN 306
gi 27262270  243 DRERKPKGATIIVMDVKTGRILGMSNRPTYDPNE-RDKYPDTAr-----------RNRAINDVYEPGSTFKIVTASAAME 310
gi 18145544  254 LNKHNADSVSIAVMNPNNGEILGMVNKPGFNPNNpYEGSEAFKgkdesaklqnmwRNTIVSDAFEPGSIFKIITSIAAIE 333
gi 499268036 253 LVNNKAKAVSILIMNPKNGEILAMANKPDYDLNDpWDKSKSYDelq------kswRNRVVSDAFEPGSIFKVITSSAAMS 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936  307 ENLVDlEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKDRLFKYIRNFGFGQKTGIDLQG 386
gi 27262270  311 EGAVK-ESDKFYDPGYATIGDRKVRCWKPDGHGSQTFPEVVQNSCNPGFIQIGMNLGVEKFYNYLLAFGFGSPTGISMNG 389
gi 18145544  334 ENIAG-KDEVYYCDGSLNVAGKNIKCWKPGGHGVQNFNQTLENSCNVAFMEMGAKLGAEKLNEYIKLFGFGTQSGIDLPG 412
gi 499268036 327 LGIVH-ENDKFNCGGSITVAKKTIHCWKRTGHGEETFVDILKNSCNVGFAELGERLGAKNLNDYINKFGFGRKTGIDLPG 405
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936  387 EGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAAAVNGGTLYQPYIAKEFIDPKNn---QVVSKKTPVAKRKVIS 463
gi 27262270  390 EAAGILVPKKTVKPIDLATMSIGQANAVTPIQLITAVSAVANGGKLMKPQLVEKILDSQG----AVIQTFEPEVVRQVVS 465
gi 18145544  413 EATGIVKNVEDISAVDLATISFGQTNTMNGIQFMTALNAVANGGDLIQPHIMKELSHKDDngtkIIDEVFVPKIQENIVD 492
gi 499268036 406 EARGIIRPTNKIGPVDLATIAFGQSNTVSMVQYMQAFNSVANGGYLITPHVMREISHVENnr-qVVDKEYSDYNKKRILD 484
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936  464 KETSEKVRYALENVVAKGSGKGAFIDGYRVGGKTGTAQKVK--DGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVT 541
gi 27262270  466 KETAQKLNLILETVVSKGTGTNAYIEGYRVGGKTGTAQKIKp-NGGYMEGEYVVSFVGIAPANDPAVACLVVVDAPQGVQ 544
gi 18145544  493 EKSTMRVKEALESTVSNGSSKDAGIEGIKVAGKTGTAEKVDpeTGTYGAG-YIASFAGFAPYDNPQVSLIVIIDNPKNGE 571
gi 499268036 485 ESMTATLRGYLEKVVSEGGGKKAFIDGYHIGGKTGTAQKPNpnGGGYEHGKYIASFVGMAPASDPKITVMVSIDEPDPSN 564
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42738936  542 QFGGVVAAPIVGNILRDALPVMGVKPRKEQVER-EYKWgdtPTVEVPNLIGMKKKDLQTQLVDLKLDISGD--GEKVIKQ 618
gi 27262270  545 QFGGLVAAPVFKSVMTDVLRHLGIPPQMNTGEApAAATnqvEAVAVPQVTGIGVDDAEDRLLHVGLGVATEgfGTRVVNQ 624
gi 18145544  572 HFGGIVAAPFAGELFNNIFNYISLN--EGQLDAkD------ESVIIPDLRGDKVTSAEKTLNELGINCVIEgdGTFVTSV 643
gi 499268036 565 YYAGQISAPVGQKVFNDIFNYLGIKPDTSSSDAaKSML---KDVVIPNIRGMKKEDAIKTLKNLNIDADVDgnGEYVSNT 641
                        650       660
                 ....*....|....*....|
gi 42738936  619 SPEAGAKVKEGSKIRIYFGN 638
gi 27262270  625 LPQPGEKVTPQTTVVLYLAE 644
gi 18145544  644 TPIPGYKVKKGDSITLYAGS 663
gi 499268036 642 TPIPGITVKEGTKVVLYTGD 661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap