2NZH,1GD7


Conserved Protein Domain Family
chap_CsaA

?
TIGR02222: chap_CsaA 
Click on image for an interactive view with Cn3D
export-related chaperone protein CsaA
This model describes Bacillus subtilis CsaA, an export-related chaperone that interacts with the Sec system, and related proteins from a number of other bacteria and archaea. The crystal structure is known for the homodimer from Thermus thermophilus. [Protein fate, Protein folding and stabilization, Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 131277
View PSSM: TIGR02222
Aligned: 8 rows
Threshold Bit Score: 174.912
Threshold Setting Gi: 12697606
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NZH_A         7 IDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVL 86
gi 33573250    6 WTDFAKVELRVGRIVQALPFPEARKPAYILHVDFGAEIGVKKSSAQVTHLYQPETLLGRLVVAVVNFPKKQIGPLQSECL 85
gi 12697606    4 LEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLG-PLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVL 82
gi 20514988    4 YEDFLKLDIRVGRIIEVEDFPKAKKPAYKLKIDFG-ELGVKTSSAQITKLYKKEDLYNRLVVCVVNFPPKKIADFVSEVL 82
gi 10640360   23 YGTFSKVDMRVGKIVDVQDFPEARKPAYRIRIYFGEDIGYRNSSAQITN-YTKEELIGMNIIAVVNFPPKQVANFISEVL 101
gi 489199952   6 WQDFERVELRVGTILSAAPNPKARKPAYVLEVDLG-PLGLRTSSAQLTAHYQAEQLVGRQVLCVCNFAPKQIAGVRSEVL 84
gi 2851549     4 IDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVL 83
1GD7_A         4 LEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLG-PLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVL 82
                         90       100
                 ....*....|....*....|....*..
2NZH_A        87 VLGGIPGQGDVVLLQPDQPVPNGTKIG 113
gi 33573250   86 VTGFHNAQGEVALCVPDRDVPLGTKLL 112
gi 12697606   83 VLGVPDEAGRVVLLAPDREVPLGGKVF 109
gi 20514988   83 VLGVDDKEENVVLLQPEREVKVGNKVY 109
gi 10640360  102 VLGAITDKG-VRLIQADSLSRPGDYIA 127
gi 489199952  85 VTGVYDSEDKVVLAGFDKPLPNGARLA 111
gi 2851549    84 VLGGIPGQGDVVLLQPDQPVPNGTKIG 110
1GD7_A        83 VLGVPDEAGRVVLLAPDREVPLGGKVF 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap