Conserved Protein Domain Family
two_anch

?
TIGR02226: two_anch 
N-terminal double-transmembrane domain
This model represents a prokaryotic N-terminal region of about 80 amino acids. The predicted membrane topology by TMHMM puts the N-terminus outside and spans the membrane twice, with a cytosolic region of about 25 amino acids between the two transmembrane regions. Member proteins tend to be between 600 and 1000 amino acids in length. [Hypothetical proteins, Domain]
Statistics
?
PSSM-Id: 131281
View PSSM: TIGR02226
Aligned: 12 rows
Threshold Bit Score: 39.6385
Threshold Setting Gi: 21111036
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32444807    1 MNFLNLGLLAGALAFVVPLAIHLLFRSRYRSMD--WGAMFLLQDVVAKNRRRMQWHQWILLALRCAIPILLALAMARPLL 78
gi 32447173    1 MTFFNATLILGTLAAVVPIALHLLARREPQRVV--FPGVRFLRPKLSSQRSRLRIRRWWLLALRVLAVIALAVALARPHI 78
gi 32443097    1 MSFLSVAFLFALPLVAAPLLLHLFDRRRNETVQ--WGAMQFLMEASARKTSSRKLKQWLLLLLRCLAIAALIFALARPLL 78
gi 32446203    1 MSFLQPWMLFALPIALLPILIHLINQRRYQTTQ--WAAMMFLLAANRMNRGYARIRQWAILALRTLVLLALIIAIGRPLA 78
gi 32445773    1 MSMLAPFFLAGALAVAAPILFHLIRQHPKGAVP--FSSVMFLREVPPRLTRRSRLDQWPLLLLRALALLLLAAAFARPFL 78
gi 21111036    2 MLLLFPAGLAALAALVLPLLIHLARRSEHRPTD--FAALRWLRALP-RPRHRVRFDEWPLLLVRLVLLAALAVLLAEPAL 78
gi 13424436    3 PALLLPAALAALLAVAVPLAIHIARRTETKTID--FAALRWLNPNP-KPVQRLQLDERLLLAVRIALIVAIAIALARPLL 79
gi 14023185    6 LSFGAPMVLWGLLA--LPVIWWLLRLTPPKPQAeiFPPLKILARVLKREETPHQ-SPWWLTLLRLLMAGLIVAALAEPVF 82
gi 23348410    6 LAFGSPLILAGLIA--LPVIWWLLRMTPPRPQEetFPPLRILAQVFRREEVPSK-SPWWMTLLRLLIAGLVILALASPIW 82
gi 39648106    7 LSFAQPLLLIGLLA--LPALWWLLRVMPPRPRRvdFPPTRLLFEIAPKEETPSR-TPWWLTALRMLAAALVIIALAGPIW 83
gi 518394992   6 FVFTSPYILFGLLA--LPAIWWLLRLTPPRPKAevFPPLKILATVLKREETPSK-SPWWLTLLRIALAAAVIFALADPVV 82
gi 499875804   1 MTFGNPWMLLGALGALIPLLVHLFDRRRPRPHP--FGPLAFVMRSQKRTASRLKLKRLLLYALRTLILLAIPIALARPEL 78

                 ....
gi 32444807   79 SSAR 82
gi 32447173   79 DSSL 82
gi 32443097   79 PTGY 82
gi 32446203   79 SGSL 82
gi 32445773   79 RGAD 82
gi 21111036   79 RDHD 82
gi 13424436   80 RPSG 83
gi 14023185   83 NPRE 86
gi 23348410   83 NPRP 86
gi 39648106   84 NPQT 87
gi 518394992  83 NPRN 86
gi 499875804  79 TRDA 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap