Conserved Protein Domain Family
menA_cyano-plnt

?
TIGR02235: menA_cyano-plnt 
1,4-dihydroxy-2-naphthoate phytyltransferase
This family of phytyltransferases, found in plants and cyanobacteria, are involved in the biosythesis of phylloquinone (Vitamin K1). Phylloquinone is a critical component of photosystem I. The closely related MenA enzyme from bacteria transfers a prenyl group (which only differs in the saturation of the isoprenyl groups) in the biosynthesis of menaquinone. Activity towards both substrates in certain organisms should be considered a possibility. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131289
View PSSM: TIGR02235
Aligned: 5 rows
Threshold Bit Score: 384.864
Threshold Setting Gi: 35212143
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33237178  20 LWKKAIKWPLYSVAIMPVILAAGWKQGAGEIIRLDQLVGFLIASILLLIWENLTNDLFDSTTGVDEFKLHSIVVLTGRRR 99
gi 22295923  13 LWWAAIKLPLYSVAVMPIWLGTAVAIAKTGRGHWWPFGLFLTAAVLILAWLNLSNDVFDAETGIDRHKYHSVVNLTGKKQ 92
gi 3183077   18 LWLAAIKPPMYTVAVVPITVGSAVAYGLTGQWHGDVFTIFLLSAIAIIAWINLSNDVFDSDTGIDVRKAHSVVNLTGNRN 97
gi 33633678   8 LWKQAIKWPLYSVAILPVFISGAYTLNSFKNVKIYNLIAFTIAAILILIWENLTNDLFDSETGIDEFKFHSIVNLVRSKT 87
gi 35212143   8 PWLNSFNPLIYTASVIPILVGTAFAWWQGGVFDLQRFALTLAGLVFVHAWINLTNDVFDWDTGVDRNKLNSLVRTTGSRS 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33237178 100 LIRNLAYFILFLGLILILILASRSH-QAVFFLVIGSCALGYLYQGPPFRLGYQGLGEPLCWLAFGPLATAASLLVLSTnv 178
gi 22295923  93 LIFWLSNLCLLLGLLGIAAISWLQQdGTVLGLVLLCCALGYSYQGPPFRLGYLGLGEPICFICFGPLAIAAAYYSQVQ-- 170
gi 3183077   98 LVFLISNFFLLAGVLGLMSMSWRAQdWTVLELIGVAIFLGYTYQGPPFRLGYLGLGELICLITFGPLAIAAAYYSQSQ-- 175
gi 33633678  88 IVSITAYTSLLIGLVVIAIISISTS-INVMLLVGACCFLGYLYQGPPFRLGYQGLGEPLCWLAFGPFAYAAALIALNPsd 166
gi 35212143  88 QVLWVGNIFLSIGYVCFWALQDWWL----LAFGSLGIFLGYAYQGPPFRLAYKGLGEWISSSCFGPIAVLTATRAQTG-- 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33237178 179 nHTNPIPWKAAISLGagpaVATTLVLFCANFHQVSEDAAHGKKTLLVRLGTGRAAAIVPWFILLCLGLEWIPIVYGQWPV 258
gi 22295923 171 -TFSASIWPVAILNG----LTTTLILFCSHFHQVADDLAAGKRSPVVRLGTARSAQLVYGACGLFYGVLVASVLWGLLPW 245
gi 3183077  176 -SFSWNLLTPSVFVG----ISTAIILFCSHFHQVEDDLAAGKKSPIVRLGTKLGSQVLTLSVVSLYLITAIGVLCHQAPW 250
gi 33633678 167 iYMISIPWKESLLLGsgssLATTLVLFCSHFHQIKEDKEHGKNSPLVLLGAKKGAKIIPWIVFIIYVFQLFLIINGFIPI 246
gi 35212143 162 -SWELGALLAGIAVG----SWTATILYAHHFYQYEDDREFDKRTPVVRWGPELAAKRFWWVISPSYVVLLLAVIGGFLPW 236
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|...
gi 33237178 259 TALLGGIGIPPAIKLIRLLTDHHNHPKLISESKFLALRFQALNGIGLSIGLAL 311
gi 22295923 246 PTLLALSSLPWAIYLCQRMAQFHSVPEQIKNSKFIAVQLHFWSSLLLGLGYLL 298
gi 3183077  251 QTLLIIASLPWAVQLIRHVGQYHDQPEQVSNCKFIAVNLHFFSGMLMAAGYGW 303
gi 33633678 247 LCVLFLISFPQSLKLINLLKYSYNKPEAIKNCKFIAIKFQTLNGIGLIAGFII 299
gi 35212143 237 TVLAALATIPLAVSLVSFVRENATNPAVVVGALPLAARFHLVSGALLTLGLLA 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap