1PZN,1T4G


Conserved Protein Domain Family
recomb_radA

?
TIGR02236: recomb_radA 
Click on image for an interactive view with Cn3D
DNA repair and recombination protein RadA
This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131290
View PSSM: TIGR02236
Aligned: 10 rows
Threshold Bit Score: 546.264
Threshold Setting Gi: 13878695
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PZN_A        37 IEDLPGVGPATAEKLREAGYDTLEAIAVASPIELKEVAGISEGTALKIIQAARKAANLGTFXRADEYLKKRATIGRISTG 116
gi 34395788    6 LEELPGVGPATAEKLKEAGFNTIEAVAVASPSELATTAEIGESTAAKIINAARQAADIGGFETGDLVLERRKLVGKLTTG 85
gi 3914552    14 LEDIPGVGPETARKLREAGYSTIEAVAVASPSELANVGGITEGNAVKIIQAARKLANIGGFESGDKVLERRRSVKKITTG 93
gi 387912860  41 IEDLPGVGPATAEKLREAGFDTLEAIAVASPIELKEVAGISEGAALKIIQAARKAANLGTFMRADEYLKKRESIGRISTG 120
gi 3914551     4 LEDLPNVGAKTAQKLRDAGFGDMMRLATATAKELSVKAEIGEGVAEKVIEAARRAEKID-FETAFDVMERRKDVGRITTG 82
gi 20139514   27 VEELEGIGRVTGAKLKERGYYTVRDIAFASVKELAEIIGN-EDRAQQIIEAARKMLGLHSFISALEVYERRKKIRRISTG 105
gi 13878703   11 ITDLPGVGPTTAQKLMEAGYTTLEAIAAATPQEVSQATGIPILTAQKIVDAAREALN-IDFKTAYDLKIESMNIKKITTG 89
gi 13878668    5 LTDLPGVGPSTAEKLVEAGYIDFMKIATATVGELTDIEGISEKAAAKMIMGARDLCDLG-FKSGIDLLKQRSTVWKLSTS 83
gi 13878695    6 LEELPGVGPATAEKLRDNGFDAFQSLAVANSAELSNTADIGESTAADVIQAAREAADVGGFETGATVLERREQIGKLTWN 85
1T4G_A         5 LTDLPGVGPSTAEKLVEAGYIDFMKIATATVGELTDIEGISEKAAAKMIMGARDLCDLG-FKSGIDLLKQRSTVWKLSTS 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PZN_A       117 SKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVXVQLPP---------EEGGLNG-SVIWIDTENTFRPERIREIA 186
gi 34395788   86 CTEFDEMMGGGIETQAITELYGEFGSGKTQVAHQLAVNVQMDR---------EHGGLGG-SVIIIDTENTFRPERITQMV 155
gi 3914552    94 SKDLDELLGGGVETQAITEFFGEFGSGKTQICHQLAVNVQLPE---------DEGGLEG-SVIIIDTENTFRPERIIQMA 163
gi 387912860 121 SKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPP---------EEGGLNG-SVIWIDTENTFRPERIREIA 190
gi 3914551    83 SKALDELIGGGIETQAITEVFGEFGSGKSQLSHELAVTVQLPE---------ERGGLDA-EAVFIDTENTFRPERIEQIA 152
gi 20139514  106 VRSLDELLGGGIETRAVTEIVGEFGSGKTQLCHQLAVMVQLPE---------ERGGLGA-KAIYIDTENTFRPERIMQIA 175
gi 13878703   90 SRNLDELLGGGIETKTITELFGEFGSGKTQICHQLSVNVQLPE---------DKGGLEG-KAVYVDTEGTFRWERIEQMA 159
gi 13878668   84 SSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEflfydeeavSKGEVAQpKAVYIDTEGTFRPERIMQMA 163
gi 13878695   86 IPEVDDLLGGGVETQSITEVYGEFGAGKSQVTHQLAVNVQLPT---------EYGGLHG-RAVFIDSEDTFRPERIDDMV 155
1T4G_A        84 SSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEflfydeeavSKGEVAQpKAVYIDTEGTFRPERIMQMA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PZN_A       187 Q--NRG-------LDPDE---------------VLKHIYVARAFNSNHQXLLVQQAEDKIKELLNtdrPVKLLIVDSLTS 242
gi 34395788  156 NglSEKyg---meLNPEE---------------FLQNIHVARAYNSNHQILLVDSAVDLANELKEmgkPVRLLIVDSLMA 217
gi 3914552   164 E--AKG-------LDGNE---------------VLKNIYVAQAYNSNHQMLLVDNAKELAEKLKKegrPVRLIIVDSLMS 219
gi 387912860 191 K--NRG-------LDPDE---------------VLKHIYVARAFNSNHQMLLVQQAEDKIKELLNtdkPVKLLIVDSLTS 246
gi 3914551   153 N--AFE-------LDLEE---------------VLNKIHIARAFNSSHQILMAEKVNELIQEGKN----IRLVIVDSLTA 204
gi 20139514  176 K--ARG-------LDSDQ---------------ALHNIFYARAYSSDHQMILVEQAKSIIKQHN-----VALLVVDSVIA 226
gi 13878703  160 R--GVG-------LDPDE---------------VMKNIYWIRAINSHHQIAIVDKLFTMVKND-----NIKLVVVDSVTS 210
gi 13878668  164 E--HAG-------IDGQT---------------VLDNTFVARAYNSDMQMLFAEKIEDLIQEGNN----IKLVVIDSLTS 215
gi 13878695  156 RglSDEtlqaameAHEIEgstddedtltelvdaFLDKIHVAKGFNSNHQMLLAEKAKEIASEHEDgdwPVRMLTVDSLTA 235
1T4G_A       164 E--HAG-------IDGQT---------------VLDNTFVARAYNSDMQMLFAEKIEDLIQEGNN----IKLVVIDSLTS 215
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PZN_A       243 HFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQARPDAFFGDPTRPIGGHILAHSATLRVYLRKGKGGK 322
gi 34395788  218 HFRAEYVGRGTLADRQQKLNKHMHGLLRFGDLFNACVVVTNQVMAKPDAFFGDPTRPIGGHIVGHTATFRLYLRKSKGEK 297
gi 3914552   220 HFRAEYVGRGTLADRQQKLNRHLHDLMKFGELYNAAIVVTNQVMARPDVLFGDPTKPVGGHIVAHTATFRIYLKKGKDDL 299
gi 387912860 247 HFRSEYIGRGALAERQQKLAKHLADLHRLANLYEIAVFVTNQVQARPDAFFGDPTRPIGGHILAHSATLRVYLRKGKGGK 326
gi 3914551   205 HFRAEYVGREALATRQQKLNQHLHTLQNIANTYNAAVFVTNQVQARPDAFFGSPTKAIGGHVLGHAATYRIWLKKGLAGK 284
gi 20139514  227 HFRSEFPGRENLAERQQKLNKHVADLLRLADAYDVAVVITNQVMAQPDVFFGNPLRPAGGNILAHGATYRLWLRKSKENI 306
gi 13878703  211 HFRAEFPGRENLAMRQQLLNRHLHQLMRLADIFNVAVVITNQVMARPDVFYGDPTQAVGGHVLGHAPGVRVYLKKSRGNK 290
gi 13878668  216 TFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAKPDAFFGMAEQAIGGHIVGHAATFRFFVRKGKGDK 295
gi 13878695  236 HFRAEYVGRGELADRQQKLNKHLHDLEKVGNLYNAAVLVTNQVQSNPDAFFGDPTKPIGGNILGHKSTFRMYLRKSKNDK 315
1T4G_A       216 TFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAKPDAFFGMAEQAIGGHIVGHAATFRFFVRKGKGDK 295
                        330       340
                 ....*....|....*....|....*..
1PZN_A       323 RIARLIDAPHLPEGEAVFSITEKGIED 349
gi 34395788  298 RIIRLVDSPSLPEGEAVVAVTTAGLTD 324
gi 3914552   300 RIARLIDSPHLPEGEAIFRVTERGIED 326
gi 387912860 327 RVARLIDAPHLPEGEAVFRITEKGIED 353
gi 3914551   285 RIARLVDSPHLPEGECVFKITTAGIVD 311
gi 20139514  307 RIAKIFDSPYHPEGEVSFRITEEGLVD 333
gi 13878703  291 RIARVVDAPHLPEGETVFAITEWGIRD 317
gi 13878668  296 RVAKLYDSPHLPDAEAIFRITEKGIQD 322
gi 13878695  316 RIVKLVDAPNLADGEAVMRVQDEGLKP 342
1T4G_A       296 RVAKLYDSPHLPDAEAIFRITEKGIQD 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap