Conserved Protein Domain Family
PHA_depoly_arom

?
TIGR02240: PHA_depoly_arom 
poly(3-hydroxyalkanoate) depolymerase
This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131294
View PSSM: TIGR02240
Aligned: 2 rows
Threshold Bit Score: 553.835
Threshold Setting Gi: 386063425
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130002      4 PYIFRTVELDNQSIRTAVRPGKPHLTPLLIFNGIGANLELVFPFIEALDPDLEVIAFDVPGVGGSSTPRHPYRFPGLAKL 83
gi 557586800  56 PFVFRTIDLDGQTIRTAVRPGKEGSTPLLIFNGIGANLELVFPFVQALDPELEVIAFDVPGVGGSSTPSVPYRFPGLAKL 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130002     84 TARMLDYLDYGQVNVIGVSWGGALAQQFAHDYPERCKKLVLAATAAGAVMVPGKPKVLWMMASPRRYVQPSHVIRIAPTI 163
gi 557586800 136 AARMLDYLDYGQVNAIGVSWGGALAQQFAHDYPERCKKLILAATSAGAVMVPGKPKVLMRMASPRRYIQPSYGVHIAPDI 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130002    164 YGGGFRRDPELAMQHASKVRSGGKMGYYWQLFAGLGWTSIHWLHKIQQPTLVLAGDDDPLIPLINMRLLAWRIPNAQLHI 243
gi 557586800 216 YGGAFRRDPKLAMAHASKVRSSGKLGYYWQLFAGLGWTSIHWLHRIRQPTLVLAGDDDPIIPLINMRVLAWRIPNAELHV 295
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 130002    244 IDDGHLFLITRAEAVAPIIMKFLQQERQRAVMHPRP 279
gi 557586800 296 IDDGHLFLVTRAESVAPIIMKFLAEERRRAVMHPRP 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap