3SHQ


Conserved Protein Domain Family
HAD_IIID1

?
TIGR02245: HAD_IIID1 
Click on image for an interactive view with Cn3D
HAD-superfamily subfamily IIID hydrolase, TIGR02245
This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.
Statistics
?
PSSM-Id: 131299
View PSSM: TIGR02245
Aligned: 6 rows
Threshold Bit Score: 306.359
Threshold Setting Gi: 28828788
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3SHQ_A      120 KVQRRVRDYK-IKELAPPREGKKLLVLDIDYTLFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMR 198
gi 18149200 135 KLRRRIDQYK-INLRTPCRQGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMT 213
gi 16553992 117 KISRRVKEYK-VEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMK 195
gi 4972728  120 KVQRRVRDYK-IKELAPPREGKKLLVLDIDYTLFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMR 198
gi 28828788 194 QLLAMIERSNdISLINDPRPNKKLLVLDLDHTILDFK--DQDVENMKRPHLEEFLVQSYQHYDIGIWSQTSWKWIEIKLT 271
gi 19386853 143 KLKRRASQYK-IKILNPCRKGKKLLVLDIDYTLFDHRSAAENPIELMRPYLHEFLSAAYSEYDIMIWSATSMKWVGMKMD 221
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3SHQ_A      199 LLGVASNDNYKVMFYLDSTAMISVHVPERG--------VVDVKPLGVIWA--LYKQYnSS-NTIMFDDIRRNFLMNPKSG 267
gi 18149200 214 ELGVLNNPNYKVTALLDHLAMITVQSDTRG--------IFDCKPLGLIWA--LLPEFyNPgNTIMFDDLRRNFVMNPQNG 283
gi 16553992 196 ELGVSTNANYKITFMLDSAAMITVHTPRRG--------LIDVKPLGVIWG--KFSEFySKkNTIMFDDIGRNFLMNPQNG 265
gi 4972728  199 LLGVASNDNYKVMFYLDSTAMISVHVPERG--------VVDVKPLGVIWA--LYKQYnSS-NTIMFDDIRRNFLMNPKSG 267
gi 28828788 272 ELGLLTNPRFKICFVMDQTLMFKVTTYRTIngkertkiKHNVKALEVIWKhqHLGKFfSMkNTLHVDDLSKNFAMNPKNG 351
gi 19386853 222 QLGVLGNPNYKITALMDHLAMITVQSENLSek-----kTFDCKPLGVIWA--QFPEY-NEtNTIMFDDLRRNFVMNPQNG 293
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
3SHQ_A      268 LKIRPFRQAHLNRGTDTELLKLSDYLRKIAhH-CPDFNSLNHRKWEHY 314
gi 18149200 284 LTIKPFRKAHANRDTDQELVKLTQYLLTIA-E-LSDLSSLHHSRWESF 329
gi 16553992 266 LKIRPFMKAHLNRDKDKELLKLTQYLKEIA-K-LDDFLDLNHKYWERY 311
gi 4972728  268 LKIRPFRQAHLNRGTDTELLKLSDYLRKIA-HhCPDFNSLNHRKWEHY 314
gi 28828788 352 VHVPPFKIKDAKKYGDNVLFHLTKYLKSIS-N-EEDITLIDHKEWIRK 397
gi 19386853 294 LVIKPYKRTHSNRGTDQELVKLTQYLLTIA-E-LEDLSKLDHSAWESF 339
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap