2AOQ,2AZO


Conserved Protein Domain Family
mutH_TIGR

?
TIGR02248: mutH_TIGR 
Click on image for an interactive view with Cn3D
DNA mismatch repair endonuclease MutH
This family consists exclusively of MutH, an endonuclease in some Proteobacteria that is activated by MutS1 and MutL for methylation-directed mismatch repair. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131302
View PSSM: TIGR02248
Aligned: 6 rows
Threshold Bit Score: 386.501
Threshold Setting Gi: 46396404
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2AOQ_A        2 IPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATA--GSKAEQDFSHLGVELKTLPINAEG 79
gi 46396442   6 PPQNLSELLKRANMMAGISLAQIATHRGINVPNNLKRDKGWVGQLIEMELGATA--GSKPEQDFLHLGVELKTIPIDNHG 83
gi 1171079    2 IPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATA--GSKAEQDFSHLGVELKTLPINAEG 79
gi 46396404   2 CVFCEKKLFMHAIGLSGYSIREIVSSLDQPVSNSLVRNKGFVGKILELILGVNVlhGYKC-IDFPSLGIELKSIPINSSG 80
gi 730086    10 PPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVLLEIWLGASA--GSKPEQDFAALGVELKTIPVDSLG 87
2AZO_A       13 PPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVLLEIWLGASA--GSKPEQDFAALGVELKTIPVDSLG 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2AOQ_A       80 YPLETTFVSLAPLVQNS-GVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIV 158
gi 46396442  84 KPLETTYVCVAPLTNIE-GLTWQNSLVCHKLQRVLWVPVEGERHIPVGERRIGTPTLWEPDPQEQALLQQDWEEIMELIA 162
gi 1171079   80 YPLETTFVSLAPLVQNS-GVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIV 158
gi 46396404  81 YPLEPTFICNIPLKNNSlNITWNNSYFYRKIKKILWIPIIGNRVVSFLDKIVGEAFIWTMSSVQEKILKKDWEEFMDLII 160
gi 730086    88 RPLETTFVCVAPLTGNS-GVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEEDRQLREDWEELMDMIV 166
2AZO_A       91 RPLETTFVCVAPLTGNS-GVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEEDRQLREDWEELMDMIV 169
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|
2AOQ_A      159 LGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFL 218
gi 46396442 163 LGKVEKLTARHGEVLQLRPKAANSKAMTHSISEDGSLKMTNPRGFYLKTAFTAMILNKVF 222
gi 1171079  159 LGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFL 218
gi 46396404 161 IGKVEYISSKHGQVLQVKKKCKNKHVCIKFINYNGCVKFTNPRAFYFRKSFTWSLLNLSK 220
gi 730086   167 LGQVERITARHGEYLQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALLARHF 226
2AZO_A      170 LGQVERITARHGEYLQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALLARHF 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap