2A3V


Conserved Protein Domain Family
integrase_gron

?
TIGR02249: integrase_gron 
Click on image for an interactive view with Cn3D
integron integrase
Members of this family are integrases associated with integrons (and super-integrons), which are systems for incorporating and expressing cassettes of laterally transferred DNA. Incorporation occurs at an attI site. A super-integron, as in Vibrio sp., may include over 100 cassettes. This family belongs to the phage integrase family (pfam00589) that also includes recombinases XerC (TIGR02224) and XerD (TIGR02225), which are bacterial housekeeping proteins. Within this family of integron integrases, some are designated by class, e.g. IntI4, a class 4 integron integrase from Vibrio cholerae N16961. [DNA metabolism, DNA replication, recombination, and repair, Mobile and extrachromosomal element functions, Other]
Statistics
?
PSSM-Id: 131303
View PSSM: TIGR02249
Aligned: 9 rows
Threshold Bit Score: 508.086
Threshold Setting Gi: 12746334
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2A3V_A        5 FLLSVREFMQTRYYAKKTIEAYLHWITRYIHF--HN-KKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKE 81
gi 15822601   7 LLDQVREQIRLRHYSIRTEAVYLEWVKRYIRF--HK-YRHPQEMGGPEVEAFLSDLAVRRDVSASTQNQALSAILFLYKQ 83
gi 12746334   8 LLDQVRGRLRLRHYSLRTEQAYVGWIRRFILA--NG-KRHPAQMGQAEVEAFLTDLATRGQVSAGTQNQALAALLFLYRE 84
gi 124696    16 VLDQLRERIRYLHYSLRTEQAYVHWVRAFIRF--HG-VRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGK 92
gi 41817935  20 ILNKLEEVITAKHYSKRTMEAYSYWISRFIRE--NK-NKNLKTLSDTEINAFVSRLAVKEKAAASSQNQALAALLFLYKN 96
gi 12831419   5 FLLSVKEHMLTRHYANKTIESYLFWIKRFIVF--HQ-LAHPSKLSEDDVIRFLSHLAIDEKVAVKTQALALNAISFLYRD 81
gi 11345545   5 FLLSISEHMQTRFYAKKTIEAYLHWITRYIYF--HN-KKHPSLMGDKEVELFLTHLAVNGNVAAKTQSLALNSLSFLYKE 81
gi 32443590 120 AIQEFRRSMRRAGLAIATERCYVRKLKAFMADrgLNcLADFDRIHACDVEAHLTDLAVDGNVSPSTQNQAFHSLLKFFEL 199
gi 13509250   5 FLTMIKDHMYSKRYAKSTIEAYLFWIAAYIRF--NN-MQHPSSMGDTQVELYLNHLVNSQNVAQGTQAQALNALSFLYKE 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2A3V_A       82 ILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVD-PKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGK 160
gi 15822601  84 VLQVELPWMDGVIRARRPQRLPVVLTREEVASVLAQLD-GTLWLIASLLYGSGMRLMEVLRLRVKDVEFARLEILIRDGK 162
gi 12746334  85 ILGLELPWMENLVRAKRPRRIPVVLSVEEVTRLLTMLE-GACRLMAGLLYGSGMRLLECLRLRIKDVDMVRCEIVVRDGK 163
gi 124696    93 VLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLE-GEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGK 171
gi 41817935  97 ILGLTIKTPENIVRAKKPKKLPAIMTREETAKIFSLLPeNDYGLLIRLLYGTGMRLMEALRLRIQDIDFGKNEITVHCGK 176
gi 12831419  82 FFKTPLSLDMRFQKSLTEKKLPVVLTRDEVRRFVQHID-PRYKLHIQLLYGSGLRIMECLRLRIQDIDYDYGAVRVWQGK 160
gi 11345545  82 ILKMPLSLEIRFQRSQLERKLPVVLTRDEIRRLLDVVD-PKYQLPAKLLYGSGLRLMECIRLRIQDIDFDYGAIRIWQGK 160
gi 32443590 200 VLKREMGKIE-AIRANKDSMAPTVMSPEEVGQVFEGLE-GVYLVIAKLLYGCGMRISETHRLRVKDIDFANKQIEIRQSK 277
gi 13509250  82 IIKSPLSLSLDFVKSERPRKLPVVLTQTEVSALFKHCI-TKHYLACALLYGSGMRLMEVLRLRIQDIDFDYNCVRIWDGK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2A3V_A      161 GGKNRTVTLAKELYPHLKEQIALAKRYYDRDlHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH 240
gi 15822601 163 GQKDRVTMLPRKLAAPLELHLQRVRALHEQD-LREGYGRANLPHALARKYPNAAAEWGWQFVFPSVNRSEDPRSGGIFRH 241
gi 12746334 164 GGKDRRVPLPRSLRGELMQQRERALLLHAAD-LAEGAGQVFLPHALARKYPSADVEPGWQYLFPGARRSVDPRSGRVGLH 242
gi 124696   172 GSKDRALMLPESLAPSLREQLSRARAWWLKD-QAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRH 250
gi 41817935 177 GAKDRKTVLPVSLKFPLQKHMEKVRLIHEAD-CKEGFGSVPLPFALAKKYPNASKAWAWQWVFPQARRWRNKETGEQGRH 255
gi 12831419 161 GGKNRTVTLAKELHEPLKSQMNLARNYYFKDrHVPGYAGVYISEGLRRKYPNAELDFNWHFLFPSNKLSVDKETGQLRRH 240
gi 11345545 161 GGKNRTVTLAKELYPHLKEQIALAKRYYDRDlHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH 240
gi 32443590 278 GNKSRLVPMPDDLIEPLRRFVKTRDALHEHD-LANGTASVYLPYALDRKYPSAHRELKWQYLFASHRLSRDPRTGRIHRH 356
gi 13509250 161 GGKNRVVTLAGELIPQIRTQIQLVDNYLQLDlNNPLFCGVYMPHLLRKKYPNHNKQLGWQYLFPSYKLSIDPESKQLRRH 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2A3V_A      241 HMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPLSRL 320
gi 15822601 242 HLHEKTIQRAVRNAVRRVGLHKPATPHTLRHSFATHLLESGQDIRTVQELLGHADVKTTQIYTHVLNRGGLGVLSPLDRA 321
gi 12746334 243 HVSEEIRQRAVHAARRRAGIDKPATCHTLRHSFATHPLEAGHDIRTVQELLGHKDVATTQIYTHVLGRGASAVRSPLDGL 322
gi 124696   251 HMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDAL 330
gi 41817935 256 HIDPSVIQRTLHEAVLRSGIPKPIGCHTFRHSFATHLLEAGYDIRTIQELLGHSDVKTTMVYTHVLNRGGLGIQSPIDRM 335
gi 12831419 241 HINESAIQRAVKRSALDANIEKTVTCHTLRHSFATHLLESGADIRTVQEQLGHTDVKTTQIYTHVIERGAGGVLSPLSSL 320
gi 11345545 241 HMNETVLQRTVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPLSRL 320
gi 32443590 357 HLRATTFPTHLRRAVEQAGILKHVTSHTFRHCFATHLLWQGTDIRQIQQLLGHSDVKTTEIYTHVRNPHEAKVVSPLDRL 436
gi 13509250 241 HIDEKQLQRAVKKAAFNAHINKHVTPHTLRHSFATHLLQSGADIRTVQTQLGHSDIRTTQIYTHVLQQGANGVISPFSRL 320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap