Conserved Protein Domain Family
cobalto_cobN

?
TIGR02257: cobalto_cobN 
cobaltochelatase, CobN subunit
[Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 131310
View PSSM: TIGR02257
Aligned: 7 rows
Threshold Bit Score: 1643.67
Threshold Setting Gi: 14022153
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153     1 MHILTTT--SASLDDLAEPVDLRQTPADIVALSFTDSDLAGLAAAWKADA--SRLpSMRLAALRDLRHPMSVDLWVDSVA 76
gi 231829       1 MHLLLAQ--KGTIADGNEAIDLGQTPADILFLSAADTELSSIAAAHGRRD--GGL-SLRIASLMSLMHPMSVDTYVERTA 75
gi 22294623     1 MHRILTLndLTVATDNSNVAFLQQSSAPIVILTGADTDIALLAQAYHQLP--KDFpPLRLANLLHLQAAAAIDDYGDRVL 78
gi 33237934     1 MHRIANLp---SEESTENLALLEQPQAPVLFLTSAASDISTLSYILNENKnhALKdKIRALKIDFLLHNAQVDHYLTTTG 77
gi 33634013     1 MHRILNIa---GNE-NNNVDLIEHPKADFIFITSVKADINIISDLIEDKEflLFQdNFRALEISNLNTFAQIDNYFLKTI 76
gi 33632944     1 MHRLASCp---GIDPPEDLVLVEQPPADVLLLSSAGTDLSCLEAVVQASP--DWNsRIRALHLDNLSHPAQLDHYLASTA 75
gi 489204938    1 MHLLRTQ--PGGFVPDDGIAHLAQTPAELVILCSGDSHLALLAEAARALP--DDYpSLRLANPMQLQNHASVDLYVEEVL 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153    77 RRAKIILVRILGGYDWWRYGCDQLASTAr-ERGIQLALLPGEsHDEDLRLIEASTLPRQELDALLGYFREGGPANMGALV 155
gi 231829      76 RHAKLIVVRPLGGASYFRYLLEALHAAAv-THRFEIAVLPGD-DKPDPGLEPFSTVAADDRQRLWAYFTEGGSDNAGLFL 153
gi 22294623    79 AKADVVVIRLLGGRGYWSYGLEVAQQMVs-DRGGQLILLPGD-DRPDLELMSLSSWPLAQVDRLWQYFCEGGQENIQWAL 156
gi 33237934    78 SKAQIIVVRYLGRRSDWSYGFEQLYYWSkeDKNRHLIILSGV-EEQETELNSIGNITFPLSLKLGKLLRIGGFSNMKTFL 156
gi 33634013    77 NYAKIVVLRLFGDKGTWSYGLEQLIKWKevNLNKTLLILSGT-DEEDLSLNELSSVDLDTSLKISKLLKSGGKENYRRFL 155
gi 33632944    76 TQARLIVVRLLGSRGHWSYGLEQLQRWSeeVADRQLLVLAGT-VDQQGDLRGIGTVVPALADRLAALLREGGETNMARLL 154
gi 489204938   77 RHARVILLSLHGGIGYWRYGVEQLVALA--ERGALLIPVPGD-DRPDPELSALGNLPAEQAERFWQYLRQGGLENAGQFY 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   156 QRLARLAG-QDAAVVEPVAVPKAGYYQPGRGVVPLP----------LEREGkv---apILFYRSMLLAADVAPIDVLFDA 221
gi 231829     154 DYAAALVT-GAEKPQPAKPLLKAGIWWPGAGVIGVSewqslvqgrmVAREGfepptvgICFYRALVQSGETRPVEALIDA 232
gi 22294623   157 EFIGHYGCgWGAPPRPPQRIPRWGTY-PISGQIPKD----------WPQVG-------ILFYRAHYLAGNTAVIEALAQA 218
gi 33237934   157 AIISKILT--CEI-VNFKNIKIANIDDPCRWEWTDVk---------GPKIG-------LILYSSILNSGDSNLAISIIKI 217
gi 33634013   156 YCLSYLSS--NETNIPQKYISNVSYPDPYQYDWKNEk---------GLKVG-------IISYKSLFLANEIELSNELISQ 217
gi 33632944   155 DAIQALLD--GTP-PDSEEIEVAPLADPFPWDWQDDp---------GATVG-------VVLYRAQLQAGDTALAQHLNQA 215
gi 489204938  154 RCLASQCLgRDYAWREPQALPRVALFHPRHAEATLEhw------raDWQAGrpv--vaLLFYRTHLQAANTAFIARFCER 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   222 LRQRGMTPVPIFVSSLKDPTSLAFAETALATLRPAAIITATAFAS----GAEPGv--ETLFDRAGVPVFQVIVATTRRDV 295
gi 231829     233 LEAEGVRALPVFVSSLKDAVSVGTLQAIFSEAAPDVVMNATGFAV----SSPGAdrqPTVLESTGAPVLQVIFSGSSRAQ 308
gi 22294623   219 LMQRQLAPVAVFVSSLQDPEIQRGLLAAWQG-KVELILNTTGFAI----AKASE---VDLWQQLDVPVLQVILSSSTYET 290
gi 33237934   218 LRQKGLNPRPLWVSSLKKKHVQSKVLDIYKEENVRCVLTTTSFASv---NFDQAsegKQIWDLLGVPVIQILSSNKQKKE 294
gi 33634013   218 LRCNGLSPKTVFISTLKNYDVQKELINLFKKEDIRLLITTTSFSSslnsSNENIdnnLNIFKSLNLPILQILSSNKSRNN 297
gi 33632944   216 LRERGLRPRLIWVSSLRDPAVQAGVLDLLRSQGAQVVISGTAFASv---TTEQAglgSALWDSLDRPVLQLLTAGTSRER 292
gi 489204938  226 LAAQGLNPLPIALASLKESACLAQVEDWLERSDAALIVNTTGFAQ----SNPEAp--ELRPFRRDVPVLQAICSLDNRPL 299
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   296 WENNQRGLAPADLAMHVVLPELDGRILAGAISFKGESDVDPALGHRAFANRPEPDRVAQVADRVAAFIKLQETPRAERKL 375
gi 231829     309 WETSPQGLMARDLAMNVALPEVDGRILARAVSFKAASIYDAKVEANIVGHEPLEGRVRFAADLAVNWANVRRAEPAERRI 388
gi 22294623   291 WQQQPQGLTPRDLAMHVVLPEVDGRIITRAVSFKAVSQIQPEVETAVTTYAPVGDRLDWVSDLAANWLKLRRKAPAERRI 370
gi 33237934   295 WKDSSRGLDPLDLSLQVVMPELDGRITTKIGGFKKVVEQNLNLYSPVYRINPDKENIKWIADYTKSWVSLQKKDKQEVKI 374
gi 33634013   298 WLHSSTGMNPTDLLMQIIIPEFDGRITTKPCAFKEVISVNRTLCSKITSYKVDFGNIKWITKLTNNYLRLNNLNNFDKKI 377
gi 33632944   293 WQQSSRGLEPLDLSLQVVMPELDARVTTRPCAFRQARPPLSGLATAITTQQPDRDGINWLVEHAACWIDLQDTPAKHRRM 372
gi 489204938  300 WLDNPQGLGPRDLAMHVALPELDGRIVTRPISFKGLAWRSERSESDVVCYLADDERMDFVAELARRWAELARKPNAEKRV 379
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   376 AVLIPDYPSAPGRTGYAVGLDVPSSVLAMLHDLKEQGYGVEG--IPQSPRALLDLLERGGDG--LGLEDYVGLSKELPAE 451
gi 231829     389 AIVMANYPNRDGRLGNGVGLDTPAGTVEVLSAMAREGYAVGE--VPADGDALIRFLMAGPTN--AASHDREIRERISLND 464
gi 22294623   371 ALILANYPCRDGRLANGVGLDTPNSTVELLKALQAAGYDLGPdpLPRDGDALIQHLSRYRTNdpEGNHWRLPRYTLSLDT 450
gi 33237934   375 IINLSNYPIKDGRIANGVGLDSPESIVVLLEQLKLNGYYLGNkpIPSNSKQLMKLIINGRTNs-LESSNNEPLEYISLDQ 453
gi 33634013   378 SLVIANYPVKNGRIGNGVGLNTPQSVLNILYWLKNEGYDLGSgeLPKNSSELISLLIKTRTNd-IESQNNKPLDFLSLNE 456
gi 33632944   373 AMVLANYPVRDGRVANGVGLDTPASVVNIIGWLADAGYQLGEhpIPSNGDRLIASLLAGRTNs-AEGRYRPPLDHLPLET 451
gi 489204938  380 ALVLANYPTRDGRIGNGVGLDTPAAALNILRALRQQGYPVDG--LPASGTELIRQLLGGVSNdlEHLDLRPCAQSLALDD 457
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   452 VMTAVEAAWGKAEEETGLREGGASHKPSLSSKkHFPFRATTFGNITVALAPDRGRSADRRADYHDPTLAPRHALLAFGLW 531
gi 231829     465 YKTFFDSLPKQIKDEVAGRWGVPEADPFFLDG-AFALPLARFGEVIVGIQPARGYNIDPKESYHSPDLVPPHGYLAFYAF 543
gi 22294623   451 YQHYFRNLPRAVQTAINQRWPAPTSD--------LPIAGDCWGNIFVGIQPSRGYDRDPSLNYHAPDLEPTPEYLAFYFW 522
gi 33237934   454 YLKFWSTFSLTAKQKIKLNWNKPSLSIDLE-KkGFPVNGIRFGNIAILIQPSRGYTEDNINDIHSPTLAPPHRYIAQYFW 532
gi 33634013   457 YLEFWNKLSLKPKNLIVDRWGIPSNSQDLE-KqGFSINGLLFGKICLLIQPQRGYDIESNKDIHSPDLPPPHRYLAQYYW 535
gi 33632944   452 YQAWWDTIPSEAKARIVSRWGEPQQACDLDGErGFAIHGLRYGHLVVLLQPDRGYDPDQIADLHSPDLPPPHRYLAQYLW 531
gi 489204938  458 YLACFARLPERNRQAVLARWGEPQQDPMFRDG-RMMVAGLRYGLTFVGIQPARGYQLDPAAVYHDPDLVPPHGYLAFYFW 536
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   532 LRKSLGVHALIHVGAHGTLEWLPGKTVALSQTCFPEIVTGALPVIYPFIVSNPGEAAQAKRRIAAVTLGHLPPPLTGAGL 611
gi 231829     544 LRQQFGAQAIVHMGKHGNLEWLPGKALALSETCYPEAIFGPLPHIYPFIVNDPGEGTQAKRRTSAVIIDHLTPPLTRAES 623
gi 22294623   523 LRHVFGADAIVHVGKHGNLEWLPGKGIALSEACFPEIALGPVPHFYPFIVNDPGEGAQAKRRAQAVILDHLTPPLTRAEL 602
gi 33237934   533 IYKFFKADVMIHMGKHGTAEWLPGKSVGLSSSCFPQLVIPPIPYLYPFIVNDPGEGSQAKRRTHSIIVDHLTPPLARAGL 612
gi 33634013   536 IESKFDSNAICHIGKHGTIEWLPGKSIGLSDECFPSIICPPIPNIYPFIVNDPGEGSQAKRRTHATIIDHLTPPLDRSDL 615
gi 33632944   532 LREVHGSQVMVHVGKHGSAEWLPGKGVGLSAACGPNLALGALPHLYPFIVNDPGEGSQAKRRGHAVVLDHLTPPLGRAGL 611
gi 489204938  537 LRHAYRADALLHVGKHGNLEWLPGKGVGLSAECWPDALLGPLPNIYPFIVNDPGEGAQAKRRTQAVIIDHLMPPLTRAES 616
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   612 DENQHKLERLVDEYAQADGLDRRRRDRLARLIVDTAQKTGLAAEAGVAR--TD--APDEALRRIDAWLCDLKDFAIKDGL 687
gi 231829     624 YGPLKDLEALVDEYYDAAGGDPRRLRLLSRQILDLVRDIGLDSDAGIDR--GD--SDDKALEKLDAYLCDLKEMQIRDGL 699
gi 22294623   603 YGGLETLSHYIEEYYAAEQFDRPRLTVLRQQIEALVKELDLDQEISAPN--PEe-TWTAWLARTDGYLCDLRDAQIRDGL 679
gi 33237934   613 SQQLIDLENLLDEYYETLLLDSDRNKIVKEKLDSIIIKENFDSIISTKDklNN--KVDSIYENLDSYLCELKESQIRTGL 690
gi 33634013   616 YGKLSILEECLDEYYEAKLLNSKRINIIEKSILEIIKND-FKDIIFFDE--SN--K---I-EKIDSYLCELKESQIRTGL 686
gi 33632944   612 HGGLQKLEGLLDELVEARQLGGERTQVLETQVLSTLQDLDWPEIPSRRElkKNpdRLNSCLDQAETYLCELKESQIRTGL 691
gi 489204938  617 YGPLRDLERLADEFYDASLLDPRRAEQLRGEILVLLRDNRLDREIGLQL--SD--DPDSWLPQLDAYLCDLKESQIRDGL 692
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   688 HIYGRAPD------------------------------------------------------------------------ 695
gi 231829     700 HIFGVAPEgrlltdltvalarvprglgeggdqslqraiaadaglrgfaiptsaggnpardaqpfdpldcvmsdtwtgpkp 779
gi 22294623   680 HILGQCPQgrqlrdlilaiarspsdqhrgltra---------------------------laqdqgvdldpltadptaps 732
gi 33237934   691 HILGRMPSdsklgeltlaiamaptfntsgisqyls----------------------rllninidpwadnegdsisevdn 748
gi 33634013   687 HIFGTRQKfineinliisiarvptskrsgiiqyia----------------------snlnldldpwtnnydqvlsdndk 744
gi 33632944   692 HRYGQCPDdaamtellmalarpplqgqpgltqlma----------------------reaglefdpwsqddgesldpadr 749
gi 489204938  693 HVFGESPSgrlrldtllallrvprgdgkganagllks------------------laddlglgfdplacdmgeawqgarp 754
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   696 ----DESDAMRR------------------------------------------------------------------QS 705
gi 231829     780 silaDLSDAPWRtagdtveriellaanlvsgelac--------------------pdhwantravlgeietrlkpsisNS 839
gi 22294623   733 pvlgYRSVGQWQnaleetaatlvegllrgtpnl------------------------pggsatqqvldwirtvlypalQQ 788
gi 33237934   749 nrlfDLNQLKFRikgdyitwinnqaqsvvsyylrkalnkrdincipnnlinelrplllpgplpleiykikeslipsilKS 828
gi 33634013   745 eiisNYSKDNINsfrralefienqakyliyhyfykdqitlnelei-lenknilllfnvgkkhkdffnlihkeilepivKS 823
gi 33632944   750 arlaALGCQRCRrvgdgsawleqqgllilrqlvlheqavd-----------latpfrslvetsaplrqrclelwkrlqAC 818
gi 489204938  755 acleERGGEPWRtlgdtrerlellalhwierclgges-----------------ppatwrasgevlrglceqvaptldAC 817
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   706 AEAEKAALLAALDGRHVKAGPAGAPARGRSDVLPTGRNLFTSDPRTMPTPTAYDLGKAAAEEVVRGYLQSHGDWPRSLVI 785
gi 231829     840 GAAEMTGFLTGLSGRFVAPGPSGAPTRGRPDVLPTGRNFYSVDSRAVPTPAAYELGKKSAELLIRRYLQDHGEWPSSFGL 919
gi 22294623   789 TRQEIDHFLHGLNGGYVPSGAAGAPSRGRPDVLPTGRNFYAVDLRSVPTEAAWALAERSAAALIERYCQEQGDFPRTLGL 868
gi 33237934   829 PSNEIKSLFKGINGLRVSSGPSGSPTRGNVEVLPTGKNFYSVDLRCLPTQSAWDLGRKSAEQLCEIYLLEKGIHMSNLAM 908
gi 33634013   824 TINEKASFINALNGIYVSSGPSGAPTRGKTEVLPTGKNFFSIDSRGLPTESAWIVGCESASQIIDLYKQDHGQDLKKLAI 903
gi 33632944   819 DEAERQGLMRGLEGRRIAAGPSGAPSRGRPDVLPTGRNFYSVDLRGLPTEAAWDLGRRSAERLLDLHLQDEGEPLRHLAL 898
gi 489204938  818 GGAEIDGLLAALEGRFVPAGPSGAPSRGRLDVLPTGRNFFSVDVRNLPTPTAWRIGFQSANLLLERHLQEHGDHLRQLGL 897
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   786 DLWGSASLRTGGEEIAQGLALMGCRPQWDAATGRITGIEVLPPATLGRPRVDVTWRISGLFRDMFPTQIALIDAAANAVA 865
gi 231829     920 TAWGTANMRTGGDDIAQALALIGAKPTWDMVSRRVMGYEIVPLAVLGRPRVDVTLRISGFFRDAFPDQIALFDKAIRAVA 999
gi 22294623   869 SVWGTATMRTGGDDIAQALALLGVRPVWEGASRRVVDLEVIPLSLLGRPRVDVMLRISGFFRDAFPNLIALFDEAVQRVS 948
gi 33237934   909 SVWATSTMRNGGEDICQFLSFLGIRPVWDNNTKKLIDLEVIPLQILGRPRVDVTLRISGLFRDAFPNLIELVNKALDMIL 988
gi 33634013   904 SVWATSTMRNGGEDVCQILYLLGVKPIWDGPSRRVIDLEIIPLSILNRPRVDVTLRISGMFRDAFPQLISLVYKAVKLVS 983
gi 33632944   899 SVWGTATMRNGGEDIAQLLALIGVRPVWDGPSRRLVDLEVIPADLLGRPRVDVVLRISGLFRDAFPQLVSWVNQAQQMVA 978
gi 489204938  898 SVWGTATMRTGGDDIAQALALLGVRPVWQAGSQRVADFEILPVSLLDRPRVDVTLRVSGFFRDAFANLIRLFDAAVQAVA 977
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   866 ARdEEDSENPLAARTRADG---------------KISPRIFGTSPGTYGAGVEDLLSSGDWAAREEIGRAYLDATSHAYG 930
gi 231829    1000 LE-EDDADNMIAARMRAESrrleaegveaaeaarRASYRVFGAKPGAYGAALQALIDEKGWETKADLAEAYLTWGAYAYG 1078
gi 22294623   949 QLdEPPDQNPLAAQVAKETaywqqqglsldqaqqRARFRIFGSKPGAYGAGLQGLIEAQNWRGDEDLARAYIHWSSYAYT 1028
gi 33237934   989 NIdEPLELNPLLKSSKNGE----------------YISRIFGSSPEGYGTGLQELINIGIWEETSELANCYLKSSQWEYT 1052
gi 33634013   984 QLdEDKKLNPISASYKDGD----------------SLNRIFGSAPGSYGAGLQELISNSSWENKNDFADSYLNWSKWIYS 1047
gi 33632944   979 LLeEPEEINPLASLTRRDG----------------PQGRIYGSAPGAYGAGLQALIDSGAWESRRDLGEAFLCWSQWRYD 1042
gi 489204938  978 ELdEAEELNPLAARVRLERqrleaqgtapaearrQAGWRIFGAKPGAYGAGVQGAIEERLWETRADLAEVYLNWGGYAYG 1057
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153   931 gAGGEGISAPGAFETRIAEADLLVHTGDDPGRDILEGSADVAFIGGFSAALAALG-RNADVIVLDTTDPQKPKPRSVSEA 1009
gi 231829    1079 -AGEEGKAERDLFEERLRTIEAVVQNQDNREHDLLDSDDYYQFEGGMSAAAEQLGgHRPAIYHNDHSRPEKPVIRSLEEE 1157
gi 22294623  1029 -GAAHSHNAAEALEQRLSQLQVVLQNQDNREHDLLDSDDYYQFQGGLTVAVRSRSgQQPTVYFGDHSRPEQPKIRTLQEE 1107
gi 33237934  1053 -NSKEPTLNLNGLKESLKKIQVVLHSQDNREHDLLDSDDYYQFHGGLSAAVKELSgICPDIYFGDNSRKNKPRIHKLEKE 1131
gi 33634013  1048 -DGNEPIENKKELEKALKNIQVVIHNQDNREHDILDSDDYYQFQGGISSAINKLQgKFPEIYHGDLSKYRLSKINKLSYE 1126
gi 33632944  1043 -GSAEPVADRSGLEQALSSVQVVLHNQDNREHDLLDSDDYYQFHGGLSAAAEQVSgQRPQLWFGDHSRRERPRLHRLEKE 1121
gi 489204938 1058 -AADDGTPARERFAQRLERLQAVLHNQDNREHDLLDSNDYYQFQGGMLAAVETLRgAPVASYHGDHSQPDNPRIRTLKEE 1136
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14022153  1010 VSRVVRARAINPRFISGQMRHGPRGASEFAETVDRLVGFAETTHAISGALIEAVHDAYVGDADVRAFILRENPAAAKVIA 1089
gi 231829    1158 IGRVVRARVVNPKWIDGVMRHGYKGAFEIAATVDYMFAFAATTGAVRDHHFEAAYQAFIVDERVADFMRDKNPAAFAELA 1237
gi 22294623  1108 LLRVYRSRVVNPKWLTGVKRHGYKGAFEMAATVDYLFGYAATARCVPDYVFTGIAQTYLLDSEMQAFVAHHNPWALRDMA 1187
gi 33237934  1132 IDKVVRSRLLNNKWIEGMKEHGYKGAFELSASLDYLFAYDATTGSVPKWCYSSIREQWLDNDSTKNFLIEQNPWVLRDIS 1211
gi 33634013  1127 INKVIRTRVLNPKWIDGMKENGYKGAFEFSATLDYLYAYDATTEIVSDWCYTQIYNSWICNEKLKKFFIENNPWALRDLS 1206
gi 33632944  1122 LDKVMRSRMLNPRWIEGMQQHGYKGAFEMGASLDYLFAYDAATDRVPDWCYGAVCDRWLADPVNQTFLSDRNPWVLRDMS 1201
gi 489204938 1137 LNRVVRARAVNPKWIAGMKRHGYKGAFELAATVDYLCAFDATSELIDDHQYALLADAYLLDAETREFVRQHNPQALRDMA 1216
                        1290      1300      1310
                  ....*....|....*....|....*....|..
gi 14022153  1090 ERFLSARRRGLWHPlRNSIDDDLAALIAEAEA 1121
gi 231829    1238 ERLLEAIDRNLWTPrSNSARFELAGIGTAATR 1269
gi 22294623  1188 ERLLEAAQRQLWQPpDPQMLDRLRSLALEAEG 1219
gi 33237934  1212 ERFLEAYNRKMWSAsKSE-LNKIKRLLLEAEK 1242
gi 33634013  1207 QRFLEIINREMWNDhTPEILENLKKIVNMADA 1238
gi 33632944  1202 ERLLEASNRGLWTGaRESQLALLKELISSSEA 1233
gi 489204938 1217 ERLVEAQRRGLWQE-PGAYREALENLLLDVEE 1247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap