Conserved Protein Domain Family
benz_CoA_red_D

?
TIGR02261: benz_CoA_red_D 
benzoyl-CoA reductase, bcr type, subunit D
This model describes the D subunit of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This family shows sequence similarity to the A subunit (TIGR02259) and to the 2-hydroxyglutaryl-CoA dehydratase alpha chain.
Statistics
?
PSSM-Id: 131314
View PSSM: TIGR02261
Aligned: 2 rows
Threshold Bit Score: 507.262
Threshold Setting Gi: 39647584
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39647584   2 TITSGIDVGTGAIKVVVFEVDGDQERCLGKRVERVRQRDPLKLAGDIYDDLLRETGLARADVAYCATTGEGESLTFHTGH 81
gi 3724171    2 TITAGIDIGTGAVKTVLFRVEGDKTEWLAKRNDRIRQRDPFKLAEEAYNGLLEEAGLKASDVDYVATTGEGESLAFHTGH 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39647584  82 FYSMTTHARGAIYLNPGSRAVLDTGALHGRAIRMDERGKVLAYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSQRADN 161
gi 3724171   82 FYSMTTHARGAVYLNPEARAVLDIGALHGRAIRNDERGKVETYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSTQADN 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39647584 162 PEKVSGICAVLAETDVINMVSRGISSPNILRGIHESMADRLAKLLKTLGSLDGTVQMTGGLALDAGLVEAMKDAVVKAKV 241
gi 3724171  162 PEVVSSICAVLAETDVINMVSRGISAPNILKGIHISMAGRLAKLLKSVGARDGVVLCTGGLALDEGLLKTLNESIQEQKM 241
                       250       260
                ....*....|....*....|..
gi 39647584 242 DVAIESHPDAIYAGAIGAALWG 263
gi 3724171  242 AVVAYNHPDSPYAGAIGAALWG 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap