Conserved Protein Domain Family
gmx_para_CXXCG

?
TIGR02264: gmx_para_CXXCG 
Myxococcus xanthus double-CXXCG motif paralogous family
This family consists of at least 10 paralogous proteins from Myxococcus xanthus that lack detectable sequence similarity to any other protein family. An imperfectly conserved CXXCG motif, a probable binding site, appears twice in the multiple sequence alignment.
Statistics
?
PSSM-Id: 131317
View PSSM: TIGR02264
Aligned: 5 rows
Threshold Bit Score: 362.556
Threshold Setting Gi: 108763999
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499875059   2 KFYRV--HPDTASGYTGSLD-AVNKWCLPGVHPCPVCRAGGGAPWLAYPCVDLSSL--PrdELKKLSDPWPV---SREEF 73
gi 499870442   2 RFYRV--EASTTSRFTGNLSrAAHKWGLPGVEPCTECGVGGGWAGLQYPCVDLSSFskA--ELKPFSDPWPV---PFEVF 74
gi 499876177  10 RIYQV--EAPRPSRYTGNLN-AAHRWSLPGLADCPGGGATWSTAGLHYPCVDLTSL--P--TRHEYEEPRPE---PYEEW 79
gi 499869663   2 RFFEV--LEDEATRNTGRID-GVSPWCIPSID-CTVCG-GYGGLGEAYPTVDLARF--A--HRALLEEPRSQqalSLEAY 72
gi 499875530   3 RFFWLreDSTVQAHTNGSLN-AAHKWGLPGLAGCPGCGETWASSGHQYPAVDLSVL--P--EQSAFLKARPE---PFTEF 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499875059  74 SRLRALIAPMAPPWALLEPGAQFGPCEGKGAGRFGPLFMQDAPTLFVQrAAFERLNAAGVRGLQGASVEVRFRGKAPPEL 153
gi 499870442  75 ARLRERVRPLAPEGAVLEPGTRLGPLSGVATGAFGHLALQDWTLVIRD-EALEVLQGEGVRGLTGCRLDVTFRGKNPPVL 153
gi 499876177  80 ARLREQVRPQVPPGFALMPGTKFGPMTGRASGTFGQLHLQAWSLSLRR-EALEQLRQSGLQGLNGCPMQLKGSGRNPPEL 158
gi 499869663  73 RHLCEQLRPWVPPAAPLEPGTQLGPVVGKAKGRFGDFYFQAPWAPWIRiSALEKLHAAGVRGLHGAPGDLGYRGQPAPPL 152
gi 499875530  75 SRLRELVRPLAPPGALLPPGTTFGPLVGTASGRFGSFAWLGSSLLLIRhEELERLREEGIRGLLGARTELRFRQKDAPEL 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499875059 154 LQLQLELHGLLHQACLPKEREPPCPACGAS-KQAWP-RTVVLDAASLPGDRDVFRHRQGWATVIVSERFVEAVNDLELDG 231
gi 499870442 154 RELQLALHGRLHPDCFVHPRAPTCAKCGSEaSERLP-DTYWLARETLPVEVDLFRLRDYPALVIATERMVVAADRLKLEG 232
gi 499876177 159 LELQLTPCGRFHPDCLPSDREPPCPTCGVE-SYGLP-APYLLDTTSIPTTVDVFRLADWPTLILATQRFVDAVQRLELDG 236
gi 499869663 153 HCLEVLVHGALHPTSHTPDWQAPCPRCGSH-RNGYPsESAVLAASTLPENIDLFRLRDFKTVIVASERFVEAVKQLRLSD 231
gi 499875530 155 LELQLDPRGQLHADCMPPDLPPRCATCGRL-GFRRP-DEPILDAASLPVDVDLFRVGNFATMIVGTERFMETVRRLELDG 232

                 ....*....
gi 499875059 232 VTFEELEVR 240
gi 499870442 233 VTFQPLDAR 241
gi 499876177 237 VTFRQVAAR 245
gi 499869663 232 IAFRELSVR 240
gi 499875530 233 VSFRELPTH 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap