Conserved Protein Domain Family
Mxa_TIGR02265

?
TIGR02265: Mxa_TIGR02265 
Myxococcales-restricted protein, TIGR02265 family
This family consists of a set of at least 17 paralogous proteins in Myxococcus xanthus DK 1622. Members are about 200 amino acids in length. No other homologs are known; the function is unknown.
Statistics
?
PSSM-Id: 131318
View PSSM: TIGR02265
Aligned: 14 rows
Threshold Bit Score: 192.147
Threshold Setting Gi: 108757903
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499876585  52 LALVEASEGIRGMHFAAVLDTVRFLggeqAVAPIQ-Q-----GGdYPADLDTTEFYPVPPFMRVFFSAARLLAPQL-GgV 124
gi 499870827   3 DELLIFEQTIEALFLRALHGRLTPE----CKARLR-Q-----AG-LDVDQKLRPAYTFDAWMTFLRITSEELFPQL-P-L 69
gi 648422370   2 aERLVFPPIVEGLFVRGLSGRVTPL----LKEQLR-S-----EG-LDLDRPLLPAYSLEAWIRCVTLTAKALHPQE-P-D 68
gi 499870066   2 PEKLVFEHTLEGLFVRGLGARVTPV----LRERLR-E-----VG-VDLERKLQPAYAFETWCFAVRVAARELHPDV-P-D 68
gi 499873838   4 SEKLVFNQTVEALFVRALENRLTPA----CREHLR-R-----AG-LELDQKLERAYTLEQWKEFLRIAAGHVYGGV-P-A 70
gi 499870381   3 SEKLMFAQSVEALFVRALGPYLTRD----GRQRLK-A-----VG-LDLSEPLRPQYTLEQWRAFLRVAAQDVFPAL-P-P 69
gi 499869668  38 rlAATDDDMARGMFFQGTLDVVGFLggegAVARCK-G-----VA-GIWEINLLHMYPITRFLRMSSTAARLLAPQLdG-F 109
gi 499876184  58 CALATPEDTARGMFFRGVLETVRRVggsaMEQLCRqP-----LP-EKRYIDFFS-YPITQFLPLAFQAAGLLSEHC-GgL 129
gi 499876438   4 PEPLVFQQSFQGLL-RALGDDLDDA----CVGRLR-E-----AG-LDARGSLALAYPLKVWVAALKVAAATLAPEA-P-L 69
gi 499872359  30 LSRAEEKDRARGMFFLGALDVVRME----VGEAAA-ArclaaSR-ERAFVPFFL-YPITSFLRLSFSAAGLLAPRL-GgF 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499876585 125 EEAMRQLGVQGTLAFINSMFGAEVRQQVG-GEPKRLVEMLPEAYRMAINFGELQVAWTGPRSGRIHMRRIFTP-VAYNEG 202
gi 499870827  70 EQGTWKLGEAYIEGFRETMLGRAVLSLLRvLGPRRTLMRATQNFRAGNNYTESKLRELGPTQFELWMNEVGPY-PAFTAG 148
gi 648422370  69 EVAWRMLGERMIDGYRDTLMGRALLGVMKlLGPWRMLSKAQHGFRTSNNYTEVRITETGPTEAEVWLNEPGML-RYFKQG 147
gi 499870066  69 DVGYALLGERLVDGYRETVLGRAAFGVIQlLGPRRCVSRARQMFRSGNNYTETRLDDVSPTEVDLWMNEAGAI-RYFTQG 147
gi 499873838  71 EAAYYSLGERFMDAYFGTFFGRALLGVVRlAGPRRMLLRAGMGFRAGNNFSVVEIVERSPTSVELRMNDVLADlPTFSAG 150
gi 499870381  70 HEASFALGARFLQGFRQTSVGRASLSLVTqLGPRRTLERVPYNVRAGNNFNEVRVEESTQDSATLWMKDVTADtPDFAAG 149
gi 499869668 110 EGVLRRMGTQATVDFVASVFGRELMQAAS-GKPRLLLQSLGEAYLAAVTYGERYPLWTGETSARFIMRRDFMP-AAYHEG 187
gi 499876184 130 AAAHRFMGQKAAHDFLESVAGRTLLMLAY-DEPRLLLGQLPTGFLAAVSYGERRMVWTGPRSGRFVMKRDFMP-TAYHEG 207
gi 499876438  70 DEAAAVVGRRFVEGFSSTLIGNALLGTVRlLGPQRMLSRMTRNLRTGTNYLETHIEQLGPTRYELTCRPVVV--AGFYVG 147
gi 499872359 102 EAAMRTIGARSAQDFLSTVVGRSFLALSG-GCPRRLVSNLPSGYSTAVSYGERDVEWVGERQGRLNMFRDFMP-HSYHEG 179
                        170       180       190
                 ....*....|....*....|....*....|...
gi 499876585 203 MLEGALLAVGAQDIQVRGGQTSLLDSEYTLSWD 235
gi 499870827 149 IIHAGLRVAGAQDIVIEMSGYDGHACVYRINWN 181
gi 648422370 148 VMLAMSRAAGGVAASVDVRAFDEHCVTYRVSWK 180
gi 499870066 148 ALRAGLRAVGAPHAEVQVRAFTDEGVTYRLTWR 180
gi 499873838 151 LLARAVELCGGGRVVSIPEEFDGTAATFHIRWS 183
gi 499870381 150 FLAETLRSAGAGHVEVKPIAFDGTAATFRVTWS 182
gi 499869668 188 VLHGVLEAVGAREVRVHGRQVGLLDSEYELSWK 220
gi 499876184 208 VLHAALEAVGARDIGVQGRELGLLDTEYALSWR 240
gi 499876438 148 LFLAGLEASGAKHPSVQIVRREGEEAVYDIAWS 180
gi 499872359 180 VLRAALAAIGARDTHIRGRATGLLDGEYEVSWS 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap