Conserved Protein Domain Family
TIGR02267

?
TIGR02267: TIGR02267 
DUSAM domain
This family consists of at least eight paralogs in Myxococcus xanthus and six in Stigmatella aurantiaca DW4/3-1, both members of Myxococcales order within the Deltaproteobacteria. The function is unknown. Some member proteins consist of two copies of the domain. This domain is hereby named DUSAM, DUplication in Stigmatella And Myxococcus.
Statistics
?
PSSM-Id: 131320
View PSSM: TIGR02267
Aligned: 4 rows
Threshold Bit Score: 115.338
Threshold Setting Gi: 108761418
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499873749   1 MPEHRTWHEIRELNRRVTDLGEPLVLTDENRALLTNTASEVAITPREVTQALQDDVSAAALLKEIAKRIRVGSRRLSRAI 80
gi 499870159   1 MAEELDWDPIRALARRVLRNGEPLMLTIEVRELLARTAREVGLSQADATSALASDTSALELLRECSRRISEGSSRMVNAL 80
gi 499873647   1 MSKTLDWNPIRALARRVLREGQPLVLSDEVRALLLRSAREVAIRDADVGRALATDVDALKLLEAISDRIRKGSLRLSRTL 80
gi 499870504   1 MAESIDWDPVRELARRVEA-GEALSLTAEVRALLLRSAREVGIPEEDAHAAVAGVATATALLHETRRRIRDGSQRLMRAL 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 499873749  81 TEAIKHQEAGDLDAARAPFLELLNVEVVPFYRELAQVQLDALD 123
gi 499870159  81 HRMYQHKRAGDLDSARQEMRDVLAAEEVPHYRAVAQGQLNLLD 123
gi 499873647  81 SEAVRRRDAGDVDGARQLLHDALAVEVVPIYRDSLYAYVESLD 123
gi 499870504  80 TGARRLRDAGDAAGARALLEDVLAVEQVPLYREQAELALEDME 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap