Conserved Protein Domain Family
TIGR02268

?
TIGR02268: TIGR02268 
Myxococcus xanthus paralogous family TIGR02268
This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Statistics
?
PSSM-Id: 131321
View PSSM: TIGR02268
Aligned: 5 rows
Threshold Bit Score: 308.338
Threshold Setting Gi: 108763991
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499873745   8 FFVVLVLASGAATAQPSPTVSGLGVRRVEISAEPSSavPPPEVQISPRMSTSFEFDSALDPAKVVLEGEE-RFSLVDLGR 86
gi 499871741  10 LAWGLLWATLAESAAVEAPAGAAVVRRIDVQAGGLA--TPPEVRISPGLSTTLFFDARIRPEQLALEGRE-RFQRFGVTE 86
gi 499876453   9 MTAVVLLLGTAALAQTPDTKRWRRIERAMVLSASAGe-PVQRLRLAPGVVTTVLLDSDAVLEGELPEALHgLFTRLDVTE 87
gi 499873641  11 lalalllaaepTRAQP-ATCREPTERPVELGAERCG--RPPEIRVGEGVATVLRFDTPLMRAEVSGPG---RFRQV-VDR 83
gi 499872496   8 ALALALVWGAAVEAQPSAAARMRRERVVTVPGAAAE--PLPVVHVAHDTPTLLLFPAPINRKTLTFDES--RIRILDAGE 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499873745  87 STLRLVPSEQLLPGERLLLTVRFQDGSVPLDAAFVLVAH-PARGERIVEVWRQARTAESYQQEAKEARAETQQCHEENAR 165
gi 499871741  87 DHLVLVPSPTFREGERLRLEVRFHDGAVPDRAVLDLVVD-ATRPERQVEIYRHARSAASYRQEVEELRAGMLRLERQVQQ 165
gi 499876453  88 THLLLQPAVAMPARGVPPLVLRFTDAAAPQRLVLELTTE-ANVVDSVIDVRRHPATVTQLEAELVALRERNALLEARLAT 166
gi 499873641  84 ELLILVPEEPVADESRATLTVYFADGAVPIQATLQLVIEtPARAERQVELFRRARTAASFQRELLETRRVLQEVREENAR 163
gi 499872496  84 RSVIVQPVADLPEGERYEVGVFFADGRAPARAAFSLVTD-PAEVDTRIDVQRPELADMACPVDVPRT------------- 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499873745 166 MRAEQREPSGIAGLLANGVIQKEEGVAAKLLRvneevRQHPGNALWAHRAWSYRAPVRVAVAVEFENPDAANPWTAEGAS 245
gi 499871741 166 LQRSRTGGEYTRESLVADILDESTVMFRHWAP-----RKVTGDFVVRRASLVRLSPGWAALRLSLLPSEAGKGWMAAGAA 240
gi 499876453 167 ARRQVPHPG-LAGAILSGAIG-ITGVLGTWMD-----TPASEAELKVRQLDSYRSGSWVALAVNLENPPGEAPWQPGIAR 239
gi 499873641 164 LRAAQARPGGLMGLWVSGDMGRTGVAAREFLDv----REHARNSLVLRSGLTFRARS-ILVVVGLKNPLGAKPWQATGAA 238
gi 499872496 150 -----PRPE---DFVLLGYVDK-EGVTATPIKl----HADSERGFSVISAMAYRGQGWVLVDATIRNYPGRAPWVPREAM 216
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 499873745 246 LVSKPGT-----SLKILTVWQKAPISRYPFGRVVVEAEATPDAAQGPFTLKLWGPGGLRAITLSGVTF 308
gi 499871741 241 LTDAQGN-----RMRTLPPWQEGPLDAAGSSPIIIVLEEPEAADFGRYTLELWDEGRKRTLKLEGFQA 303
gi 499876453 240 LTSLDSNgrptgEPMELPLLLQEPRLLPGQSAVAVVQWPAPTRPPPAYALELWDTGRRRGVRWARLKP 307
gi 499873641 239 LVGPDGA-----ELKVARVWAPASLNPGDEMDVLVETEPVEGAPRGPFTLTLWAEDGKRPIILGNIEF 301
gi 499872496 217 LTGRAGLp----LRARLVTVDEGAFVPGGFGRILAVAETAQLSNSPVYTLEVVGDG--RTLTIPNVRL 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap