Conserved Protein Domain Family
TIGR02271

?
TIGR02271: TIGR02271 
conserved domain
This model describes an uncharacterized domain, sometimes found in association with a PRC-barrel domain (pfam05239, which is also found in rRNA processing protein RimM and in a photosynthetic reaction center complex protein). This domain is found in proteins from Bacillus subtilis, Deinococcus radiodurans, Nostoc sp. PCC 7120, Myxococcus xanthus, and several other species. The function is not known.
Statistics
?
PSSM-Id: 131324
View PSSM: TIGR02271
Aligned: 4 rows
Threshold Bit Score: 117.235
Threshold Setting Gi: 15894073
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 254763399 147 MPLREEQLKVDKEDVQTGEVEIGKEVKTEKRDMDIPVRHDEIYVERRPVDENKTDAAPVNDSEEIRVPIVEEKLEVTKKP 226
gi 35213320  187 IQLLKEVLRVNKERVKSGEIRLRKEVVSETQTVEVPLMHEEVVIERRTVTDGEAAVGEIGSGETIRVPVSEERVIVDKRA 266
gi 499266712  25 LKLRKEELDINKDKVQKGEVELGKEIIEEHKAVDVPVKREEVVIERKALN-NEASDSPITDEESIKIPVSEEKVNVGKHT 103
gi 499266711  10 LKLKSEQLDIAKQWIQTEDVKAYKETSSIQKTFTIPVEREELVIEKIPT----ASDD---KKEVIRIPLSEEEVNFSKHR 82
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 254763399 227 VVTDEVVVGKRTVEENEHISETVKKEEPRLNKEGK 261
gi 35213320  267 VVSEEVTVGKRDVQETEQVTDTVRHEELRTDTEGE 301
gi 499266712 104 VLTSEVSAHKHDVEDTHHVDETLKREEARVNRTGD 138
gi 499266711  83 IILEDVSIYKNQIEDVRHIEETLKKENPKIETFGN 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap