2D40


Conserved Protein Domain Family
gentisate_1_2

?
TIGR02272: gentisate_1_2 
Click on image for an interactive view with Cn3D
gentisate 1,2-dioxygenase
This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.
Statistics
?
PSSM-Id: 131325
View PSSM: TIGR02272
Aligned: 6 rows
Threshold Bit Score: 609.475
Threshold Setting Gi: 3550667
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D40_A       20 SREQFYQHISGQNLTPLWESLHHLVPKTPNANCAPAYWNYQEIRPLLLESGGLIGAKEAVRRVLVLENPALRGQSSITAT 99
gi 3550667   12 QLTALYDEMRPAGLKPLWEVLHALVLAEPASLARAHHWHYGEVRDFLLRSGDLISAEQAERRVLILENPGLEGSSAITPS 91
gi 29136810  11 SRQQYYQHISGQNLTPLWESLHHLVPQTPNANCAPAYWNYQEIRPLLMESGNVIGAKEAIRRVLVLENPALRGQSSITAT 90
gi 5733104   12 ERKEFYSKLESHDLAPLWEVLNEVVTTKPKSNCAPHLWEFEVAKEFLMEAGTLITAKEAERRVLILENPGLKGLSRITTS 91
gi 27348357   9 EREAFYKKIDGENLTALWTVMGDLITPEPKSACRPHLWKFDVIRDYMREAGKLITAKEAERRVLVLENPGLRGQSKITTS 88
gi 17428100   9 ERDTYYSLLGGMGLAPLWESLHALVPREPKPRIVPAHWQYAAIRPLVMQAGRIISAEEAVRRVLVLENPGLPGRSSITST 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D40_A      100 LYAGLQLIXPGEVAPSHRHNQSALRFIVEGKGAFTAVDGERTPXNEGDFILTPQWRWHDHGNP----GDEPVIWLDGLDL 175
gi 3550667   92 LYAGLQLILPGEVAPCHRHTQCALRFILEGEGAYTAVDGEKAVMSPFDLVLTPGGQWHDHGNG----TDQPMIWLDGLDI 167
gi 29136810  91 LYAGLQLILPGEVAPSHRHNQSALRFIVEGKGAFTAVDGERTPMHTGDFILTPQWRWHDHGNP----GSEPVVWLDGLDL 166
gi 5733104   92 LYAGLQLILPGEVAPTHRHSQSALRFVVDGGGACTSVDGERTTMQVGDFVITPPWAWHDHVND----SDKPMIWMDGLDL 167
gi 27348357  89 LYAGVQMVVPGDVAPAHRHSQSALRFVLEGKGAHTAVDGERTAMEPGDFIITPSMTWHDHSNE----TDEPMFWLDGLDI 164
gi 17428100  89 LYAGLQLILPGEIAPSHRHTQSALRFIVEGKGAWTAVDGERTTMHPGDFIITPSWTWHDHGCPrldeGGEPVVWLDGLDI 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D40_A      176 PLVNILGCGFAEDYPEEQQPVTRKEGDYLPRYAANXLPLRHQTGN----SSPIFNYRYDRSREVLHDLTRLGDADEWDGY 251
gi 3550667  168 PTVRHFDASFAEKWPQAQHPEMAPPGDSLARYGHNLRPMRGTSADrrptSQPLFHYPYKQWRPALDHLASTAQVDPHLGH 247
gi 29136810 167 PLVNLLGCGFAEDYPEDQQPVTRKEGDYLPRYAANMLPLRHQRGN----SSPIFNYRYDRSREALHDLTRMGDPDEWEGY 242
gi 5733104  168 PMVTLFDTSFAEGYGEDIQEITRPNGDSLARYGANMLPVDFKQKGl---SSPIFNYPYERSREALEAMKKANEWDPCHGL 244
gi 27348357 165 PLVQFFDCSFAEGSKEDQQRITKPAGDSFARYGHNLLPVDVKRSSk---TSPIFSYPYAYTREALEKARASQEWDACHGL 241
gi 17428100 169 PLVQQFDAGFAENHPEAQQPVTRPEGDSFARFGHNMVPVRHRVSDp---TSPVFSYPYERSREALDTLYRHGELDPWDGV 245
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D40_A      252 KXRYVNPVTGGYPXPSXGAFLQLLPKGFASRVARTTDSTIYHVVEGSGQVIIGNETFSFSAKDIFVVPTWHGVSFQTTQD 331
gi 3550667  248 ALEFTNPADGGPVMETISAHVRLIPRGMETAPRRSTDGTIFVVVEGKGQVEIDGVSTRLSPRDVVVIPSWKRHRFHAEDE 327
gi 29136810 243 KLRYVNPVTGGYPMPSMGAFLQLLPKGFASRVARSTDSTIYHVVEGAGQVTIGNETFHFSAKDIFVAPTWHEVSFRSSED 322
gi 5733104  245 KMQYINPLDGMAAMPTISSFIQLLPKEFRTQTYRSTDATVFSVIEGQGKTRIGDKVFFWKAKDTFVVPSWYPVEHEASSD 324
gi 27348357 242 KLKFSNPETGDFAMPTIGTFIQLLPKGFKTARYRSTDATVFCPIEGRGRSRIGDAVFEWGPRDLFVVPSWHWVTHEADDD 321
gi 17428100 246 KLRYVNPATGGWPMPTIATFMQYLPAGFRGKTYRSTDATVYCVVEGRGTAHIGEARFAFAPHDVFVVPSWAPVRLDAQDD 325
                       330       340
                ....*....|....*....|..
2D40_A      332 SVLFSFSDRPVQEALGLFREAR 353
gi 3550667  328 LIIFGFSDKACQQKLGLFREEN 349
gi 29136810 323 TVLFSFSDKPVQEALGLFREAR 344
gi 5733104  325 AVLFSYSDRVAQQKLGFWRESR 346
gi 27348357 322 AVLFSFSDRPVQQKLDLFREDR 343
gi 17428100 326 AVLFSYSDRPVLAALNLLREAR 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap