Conserved Protein Domain Family
clan_AA_DTGA

?
TIGR02281: clan_AA_DTGA 
clan AA aspartic protease, TIGR02281 family
This family consists of predicted aspartic proteases, typically from 180 to 230 amino acids in length, in MEROPS clan AA. This model describes the well-conserved 121-residue C-terminal region. The poorly conserved, variable length N-terminal region usually contains a predicted transmembrane helix. Sequences in the seed alignment and those scoring above the trusted cutoff are Proteobacterial; homologs scroing between trusted and noise are found in Pyrobaculum aerophilum str. IM2 (archaeal), Pirellula sp. (Planctomycetes), and Nostoc sp. PCC 7120 (Cyanobacteria). [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 131334
View PSSM: TIGR02281
Aligned: 12 rows
Threshold Bit Score: 158.591
Threshold Setting Gi: 28855329
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23347677  114 TVTLAKSANGHFEVNGRVNGARVHFLVDTGASSVVLSQEDAERAGIDTASLNYSVPIMTANGQARAASITIATLQIGDIE 193
gi 14021515  115 TVTLDKADNGHFEARILVNGKPVRAVVDTGATSTVLTSEDAQAAGFNPAALNYTIPVSTANGMARAAAVKTDAVAIGGIV 194
gi 15074821  113 EVVLHKRIDGHFAADATINGREVSMLVDTGASSVVLTHEDAARAGLEVADLGYTITVMTANGPALAAPVILPEIAIGPIR 192
gi 13422646   53 AAQLSKDSDGHFWAQGNVDGKAVRFLVDTGATAVSLSLADAQRLGIDTSRLTYDYNVITADGRTRAAAVKLASVSIAGAR 132
gi 6831727   113 EIIIARSGDGHFYINACVNNVKIKFMVDTGASDIALTKEDAQKLGFDLNKLKYTRTYLTANGENKAAPIILNSVVIGTEF 192
gi 42409868   52 SIEFTKSYDGHFYIQAQVNDRNITFLLDTGATDIVLSQKDALHVGINLQNVQDFKIYETAKGQIKAGVVQIPQVKIGNFL 131
gi 27351996   48 AVQIQRGQGGEFALRAKINGVAAPMVIDTGATSVVLTWETAKAIGLPLEMLEYDVDLETAGGHTKAARLTLDRLAVGHLV 127
gi 28855329   58 EVQLVGNRQGHFVSTGQINGRTVEFMIDTGATDVAIPGDMADSLGLKR---GLPVTVSTANGNSQGFRTTLDRLQLGDIV 134
gi 14023506   67 KVAVTADGRGHFSTTFKLNGRQVDGMIDTGATLVAVNTSTARRIGLSLNPSDFSHEVNTANGSIKAAVVTIDRLQIGSIS 146
gi 27356412   51 SLAIGRDGRGHFQTEGRIEGQRIGFMVDTGASVVALNETSAARFGLRPSRGEYNATVSTANGTIKAARTRIAMLEVGGLV 130
gi 499273280  58 SVSLKADERGHFNATFRINGKSFDGLVDTGASMVAINETMARRLGYGVNSLDFKYAISTANGQTLAAHVKLDRVEIGAIR 137
gi 489193487  93 SFSIARGTGGHYWVAGSVNGQNMQFLVDTGATSIAMNENEARRLGIDYRVDGKPMVASTASGTSRGWRVTLDRVKIGGIE 172
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 23347677  194 RHDVRAMVTKEGLLTGSLLGMNFLQTLGGFTVRGDQLILIN 234
gi 14021515  195 RKDMPVMVAAPGMLSQSLLGMNFIGSLSGFDVRGDRMILRD 235
gi 15074821  193 RTNIRAMVAAEGRLDSSLLGMSFLSTLDFLQMRSDELRLRD 233
gi 13422646  133 VRDVDALVIEKG-LENSLLGMSYLGRLSRFEATQTSLILHP 172
gi 6831727   193 KN-IKGHVGLGN-LDISLLGMSLLERFKGFRIDKDLLILNY 231
gi 42409868  132 INDVQASVNTHS-MSHSLLGMSFLRYFH-FTIRDNKLILYR 170
gi 27351996  128 EKSVPALVVQRGQMKTNLLGMSFLDRLESWGVRADKLMLTG 168
gi 28855329  135 LHNVRALVAPGLEGEQVLLGMSALKQLE-FTQRGGNLLLRQ 174
gi 14023506  147 VDDVQAIVLDDKALSTNLIGMSFLNRLGKYQAENGTLLLVQ 187
gi 27356412  131 VRDVDAMVLPDEALSENLLGLSFLSRLKRFEYANGQMVLEQ 171
gi 499273280 138 VQNVDTMVLKDNALSNMLVGMSFLKQLSSFKVSGGEMRLVR 178
gi 489193487 173 LLGVEAAVIEGGYPTEALLGMSFLNRV-RWREEQGMLLIEA 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap