Conserved Protein Domain Family
TIGR02284

?
TIGR02284: TIGR02284 
conserved hypothetical protein
Members of this protein family are found mostly in the Proteobacteria, although one member is found in the the marine planctomycete Pirellula sp. strain 1. The function is unknown.
Statistics
?
PSSM-Id: 131337
View PSSM: TIGR02284
Aligned: 4 rows
Threshold Bit Score: 184.653
Threshold Setting Gi: 21112373
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28851752   8 TISILNDLIETSIDGKEGFQTSAENAKTPSVKTFFTRRSAEVGAAVTELQQHVQQLGGKPEDSSSVSADLHQAWVKLKTA 87
gi 32397727  13 TIEKLQKLIRANIDSYNGFHESAEELKDERLATLFRSIGDERSAMASELQQYVEFNGKEAEDDGSVAAKTHRIWINIRGK 92
gi 17429182   8 IVLALNRLIEVGKNDELSCSSGAREVHDPQLRDILTDAAQSCRASVQELQQLVRSLGGQPRDRGSMNGTLHRGWMEIRHL 87
gi 21112373   7 TEHSLNDLIAISRDGKDFYEEAASKVGDAELATLFRRIAGVKSDIVSNLSSVVASVGGKPETHGTMVGSMQQFYGKVRAT 86
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 28851752  88 FTSNDDLAVLEEAERGEDVAKKAYSKALEKSrekgVSPAVIAVIEKQYQGVLKNHDEVKALR 149
gi 32397727  93 LNGGDATVILIEAERGEDHIKEAYEDVLKDT----AGSAMNDVLTAQYAKVKAGHDKIRDLR 150
gi 17429182  88 ITPNDDDVVLEMCEREEDIARHEYQTTLQQD----LPAEIRAVVQRQYEGIQLHRERIHAMR 145
gi 21112373  87 LG-DTKYGYVAELEESEDRLLKAFDETIADQd---TPAAARDAALRLLPEVRACHDVMRNRK 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap