Conserved Protein Domain Family
TIGR02285

?
TIGR02285: TIGR02285 
conserved hypothetical protein
Members of this family are found in several Proteobacteria, including Pseudomonas putida KT2440, Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131338
View PSSM: TIGR02285
Aligned: 5 rows
Threshold Bit Score: 356.405
Threshold Setting Gi: 34103772
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24982945  12 LLCGLLPALLLQPANAK-EHLFWLVRDLPPFTIFDGP------EEGRGVIDQLLPLLIRQMPEYEHSIVRVNRARSLQML 84
gi 37625088   4 ILLILISFIISVDVTAK-ETIHWAQYDIPPFYIKDGS------YSGRGVVDVTDAMIRAELPQYNHVIIWANIARIKQMM 76
gi 39574030   5 TVLFFLAVNMFCPLAWA-EDITWIRWDDPPIFIFSGP------FKGRGLLDNVESELRRKLPQYTHKTIEGTVPRVLKEA 77
gi 34103772  14 AGFALLAFAAGASLAAEpYQITWVLSDWAPNFIIRDG------KPTTGQNDVYLKLIIARWPEAEHRFMVMSTARSTLEL 87
gi 39575150  14 GMWLSPQIAGAIEPPPQkPAIQWIVNDFPPFLVLSGEgmmvdiSKAKGPFASIYQEIERALPAYSHRFVRVSFSRAEKLF 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24982945  85 qDRDTFTCDpTLLWTPERAKYVHFS--VPALGVLSGGLVLRKENQALVAPYLDGhQVDLHGLLSKAPLKLGIVAERSYGT 162
gi 37625088  77 qQGKKVVCG-NMLKTPEREKYQTFStfHKTLSTAPHVIIPSSELNTYKQYIIDGdGVDLLRLIQSKDKLGYFIASRSYGS 155
gi 39574030  78 -EAKAPVCNaGWLDTPEWSKLFYFS--RPVFVIPANGILLPKSRLVEVRNLAP---YSLQKFLDDK-KDWKLGVGRLYGV 150
gi 34103772  88 -QRGSQLCRmNLIPTPEREKFAFFT---LTHMQLPLQLVIRRELAAQAPLNEAG-EVVLEKLILKPGLRGITAAGRSYTA 162
gi 39575150  94 -SGQGGYCTvLLQRTKEREKFLIFG--DELARAFPVGLVVHAKDTPGIRDEQK--DVDLKELLASGKFRLGVIQSRAYTQ 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24982945 163 QIDSILRQLPDSALSrHYGNEATAN-LLQMQQLGRLRLVLGYWPEVRYLIQ-------------QQGGALADYQFHTVQG 228
gi 37625088 156 KFDLAIKDKTNKRVN-YSLNAPMGN-VLDMLLKDVNGFTVAYPEEIIYYTEskfgygsstvsdlNKKAYLGKFKVLPIAG 233
gi 39574030 151 GIDDVLIKNNYQKNPqVITIATSLR-VHKMLHSNRIQYTLGYPFEAVYYNK-------------LLDGKNNEVVHIPVTE 216
gi 34103772 163 EIDRLLADRKGESNVrDIPNLPSNDgLFKLLELGRADYTLDYEPNFKYREE---------------QNRDHPLASLPIAG 227
gi 39575150 169 QIDDILSHSG--HATkIVGDSAMGN-LFLMLEKKRVNGVLAYALEKTDYER--------------NNIAVPPLKFLKVKN 231
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|...
gi 24982945 229 VNRYQFLHVGCSNSELGRAAVAHIDQLLPTLRRD-VLPGLYARWLDLALREDY 280
gi 37625088 234 QPKEISTYVAAPKTEWGDKVISDINEALSKLKSNpAYINENYMWRNLPNHDMR 286
gi 39574030 217 NAARVEVVVACPKTPWGAKVIADIDQVLQNRALLeKFEKGVDRWLSIEDQEKL 269
gi 34103772 228 -AALIPVGIACPRTRWGRMAVMKIDQLLSEAVADpAYRQAQDRWLSPESVQRY 279
gi 39575150 232 MPNHISVWASCEKSLRGEQILKDLTRAVREKNVKgKIYKYFMQELPPDMKKGY 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap