1PSU,1J1Y


Conserved Protein Domain Family
PaaD

?
TIGR02286: PaaD 
Click on image for an interactive view with Cn3D
phenylacetic acid degradation protein PaaD
This member of the domain family TIGR00369 (which is, in turn, a member of the pfam03061 thioesterase superfamily) is nearly always found adjacent to other genes of the phenylacetic acid degradation pathway. Its function is currently unknown, but a role as a thioesterase is not inconsistent with the proposed overall pathway. Sequences scoring between trusted and noise include those from archaea and other species not known to catabolize phenylacetic acid and which are not adjacent to other genes potentially involved with such a pathway.
Statistics
?
PSSM-Id: 131339
View PSSM: TIGR02286
Aligned: 9 rows
Threshold Bit Score: 146.026
Threshold Setting Gi: 23397012
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PSU_A       19 AKALGIDIISXDEGFAVVTXTVTAQXLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATA 98
gi 24984919  21 TQGLGISLLDAGPGRASLRMAVRADMIQGHGTCHGGFLFALADSAFAFACNSYDQATVALGCTIDYLAPALRDDVLTAHA 100
gi 39648644  32 SKALGMEIVEIGAGSATLAMTVTTDMVNGHGIAHGGFIFTLADSAFAYACNSYNDSTVAAQGAITFIRPGKLGARLVAAA 111
gi 3334288   19 AKALGIDIISMDEGFAVVTMTVTAQMLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATA 98
gi 46196533   6 MEALGLKVLHLAPGEAAVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGP-AVALSCRMDYFRPLGAGARVEARA 84
gi 23397012  29 AEVLGMTILDASPDLTRVALTVTEAGLNMHGTAHGGLIFSLADEAFAVISNLDAQ-AVAAETHMSFFRAAREGERLVAVA 107
gi 23492503  34 SKMLGVVITELSPEQARGHFTIREDMCNGHGTAQGGILFTFADAVFAGVCNAAGDVAVAAQVGIHYLSPARVGEVVEAEA 113
gi 11072188  33 LHANGIRFEAIGPGYAKVTMTVREDMLNGFDICHGGFITLLADTAFAYACNSGNEQTVASGISLDFMAPGRPGEVLCAEA 112
1J1Y_A        6 MEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGP-AVALSCRMDYFRPLGAGARVEARA 84
                        90       100       110
                ....*....|....*....|....*....|....*
1PSU_A       99 QVRHQGKQTGVYDIEIVN-QQQKTVALFRGKSHRI 132
gi 24984919 101 SEVSRKGRTGLYDVRIDN-QRGELVAMFHGKSYKV 134
gi 39648644 112 REVSRSGRSGIYDVRVT--SGSTVIAEFRGHSRSI 144
gi 3334288   99 QVRHQGKQTGVYDIEIVN-QQQKTVALFRGKSHRI 132
gi 46196533  85 VEVNLSRRTATYRVEVVS--EGKLVALFTGTVFRL 117
gi 23397012 108 TPERVGRTLATYRIEVRRgEEGEVLALFLGTVSRR 142
gi 23492503 114 VCRQNWGRNGITDVTLR--VGDRIVAEFRGTSRVV 146
gi 11072188 113 KEVFAAGRTGVYDISVTN-PKGELIAVMRGKSYRL 146
1J1Y_A       85 VEVNLSRRTATYRVEVVS--EGKLVALFTGTVFRL 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap