Conserved Protein Domain Family
PaaY

?
TIGR02287: PaaY 
phenylacetic acid degradation protein PaaY
Members of this family are located next to other genes organized into apparent operons for phenylacetic acid degradation. PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131340
View PSSM: TIGR02287
Aligned: 3 rows
Threshold Bit Score: 357.655
Threshold Setting Gi: 10635040
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12643682   3 IYQIDGLTPVVPEESFVHPTAVLIGDVILGKGVYVGPNASLRGDFGRIVVKDGANIQDNCVMHGFPEQDTVVGEDGHIGH 82
gi 24984924   3 CYRLDGLTPVVHPTAYVHPSAVLIGDVIVGPRCYIGPLASLRGDFGRIVLEEGANLQDTCVMHGFPGGDTVVERNGHVGH 82
gi 10635040   3 CYEIDGLRPVVHPSAYVHPDAVLVGDVHIGARCYVAPLASLRGDFGPIILREGANVQDCCVMHGFPGIDTLVEENGHVGH 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12643682  83 SAILHGCIIRRNALVGMNAVVMDGAVIGENSIVGASAFVKAKAEMPANYLIVGSPAKAIRELSEQELAWKKQGTHEYQVL 162
gi 24984924  83 GAVLHGCRVGEDSLIGMNAVVMDGAHVAPRCIVAATAFVKAGFECAAQSLVMGSPAQVKRPLSEQELAWKQRGTAEYQHL 162
gi 10635040  83 GAILHSCHVGRNALVGMNAVVMDRAVIGESSIVAACSFVKAGMEIPPQVLVAGVPAKVVRTLTRQEMDWKVEGTRCYHDL 162
                       170       180       190
                ....*....|....*....|....*....|...
gi 12643682 163 VTRCKQTLHQVEPLREIEPGRKRLVfDENLRPK 195
gi 24984924 163 AQRCMNSMVECPPLAEAEPGRPRME-DTGVRPK 194
gi 10635040 163 AARSLTTLKPCEPLTEAEADRPAMV-LPEVVPL 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap