Conserved Protein Domain Family
PaaN_2

?
TIGR02288: PaaN_2 
phenylacetic acid degradation protein paaN
This enzyme is proposed to act in the ring-opening step of phenylacetic acid degradation which follows ligation of the acid with coenzyme A (by PaaF) and hydroxylation by a multicomponent non-heme iron hydroxylase complex (PaaGHIJK). Gene symbols have been standardized in. This enzyme is related to aldehyde dehydrogenases and has a domain which is a member of the pfam00171 family. This family includes sequences from Burkholderia, Bordetella, Streptomyces. Other PaaN enzymes are represented by a separate model, TIGR02278.
Statistics
?
PSSM-Id: 131341
View PSSM: TIGR02288
Aligned: 4 rows
Threshold Bit Score: 990.537
Threshold Setting Gi: 33576842
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842    2 SQDFFERHQPMLQKALEAAAQRGYWSPFPESpsPRNYGETAAQD---GQAAFEALRGKPFALDLPQASGAVGGEVSPFGF 78
gi 28974558    9 ALELFDHHRDTLERAVQAIAERGYWSPFPES--LRQYPEEAVMG---AQAEFEALLGRHFALAGPQPIGRSGAERSPYGF 83
gi 11072185   10 PAQLFDKHHATLEAAVQAIHARGYWTPYPEMpsPKVYGETAQDD---GRRAVEACFGQDFDLGQPGRSGWMASERSPYGV 86
gi 499339552   7 AHQLIARHRPTLDLALETIRTRAYWSPHPEH--PKAYGENGSLDtaaGKAAFDALHGTRLDLGQPGTDGWVGGEVSPYGV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842   79 ELGITYPQVAPEALVAASSKALEQWRRAGPRAWVGVSLEILQRLNRRSFEMAHAVQHTTGQAFMMAFQAGGPHAQDRGVE 158
gi 28974558   84 ELGVTYDQYDTDELLERQQKALPGWRDAGARARVGACLEILQRLNALSPALAHAVMHTTGQAFMMAFQAGGAHAQDRGLE 163
gi 11072185   87 ELGVRYPVCDGQALIDAAHAAMPGWQRIGAQGRAGVCLEILERLNKRSFEIAHAVMLTTGQGWMMAFQAGGPHAQDRGLE 166
gi 499339552  85 ELGVEYPHADLDVLLPAMRAGQKAWRDAGAELRAMVCLEILQRIAARTMEFAQAVMHTSGQAFMMAFQAGGPHAQDRGME 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842  159 AVTYAWQEMSRIPGVALWEKPQGKHDPIKMEKRFTVVPRGIALVIGCSTFPTWNGYPGLFASLATGNTVIVKPHPGAILP 238
gi 28974558  164 ALAYAWRAMAEVPETACWIKPQGKQDPLLLDKRWHIVPRGLSLVIACSTFPTWNTYPGLFASLATGNPVLVKAHPGAILP 243
gi 11072185  167 AVAYAYREMKFIPHETVWEKPQGKNPPLKMKKHFEIVGRGVALVIGCGTFPTWNTYPGLFAALATGNPVIVKPHQNAILP 246
gi 499339552 165 AVAYAYVEQSRTPETAEWTKPQGKRDPLALTKRFTPVPRGIGLVVGCNTFPTWNGYPGLFASLATGNAVLVKPHPRAVLP 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842  239 LALTVQVAREVLGEAGFDPDVVLLAAHPAGDDTAQRLALDPAVRIVDFTGSSANGNWLEQNARQALVYTEKAGVNQVLID 318
gi 28974558  244 VAMSVKVAQEVLGELGFDPALVSLVVDTPEAPVAQRLALDPRVRLVDFTGSNAFGEWLEQHARQAQVFTEKAGINTLIID 323
gi 11072185  247 AAITVRIAREVLAEAGLDPNLVTLAAFD-KHEATQALATHPAVKSIDFTGGNAFGQWLISNAKQAQVYAELAGVNNVVIE 325
gi 499339552 245 LALTVQVARHVLTEAGFDPNLVALAAERPGEGIAKTLATRPEIRIIDYTGSTAFGDWLEANARQAQVYTEKAGVNTVIVE 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842  319 STDDLKGVARNLAFSLALYSGQMCTAPQNIYVPRDGIQTAEGRVGFDEVAAALGAALDKLAGDPAKAVELTGAVQNDATV 398
gi 28974558  324 STHDLKAVAKNLAFSLSLYSGQMCTTTQAIYVPRDGIRNGDEQLSFDQVADTLASAINGLLSDNDRACAVLGAIQSEATA 403
gi 11072185  326 STDQYKAMLRNLAFTLCLYSGQMCTTTQAILVPADGIDTDQGRKSYDEVCADLATSIDKFLADPAVATAVLGAIQSPDTL 405
gi 499339552 325 STDDYQGMLANLAFSLSLYSGQMCTTPQNLLIPRDGIRTDQGAKSYDEVTADLARAVDGLLGDDARANALLGAIVNPDVK 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842  399 ARIGKARQLGlPVLADSKALAHPQFEQARVHTPLLLRADAG---N-DALGQEWFGPIAFVVATDSTAHSIELAGASVRQH 474
gi 28974558  404 ARIADCRALG-EVLLDSEVREHPQFPGARVRTPLLLKVDAS---DrAAYAQERFGPIAFVIATDDSAHSLRVAREVIAEK 479
gi 11072185  406 ARIAEAPAHG-RVVRASTKIEHAEFPGAEVRSPLLLACDAA---DeKAYMEERFGPIAFVVKVADGAAAVTLSERIVREH 481
gi 499339552 405 ARLEAAAGLG-EVALASREVTNPEFPDAVVRTPVIVKLDGAkpeDeAAYTSECFGPVSFAVAVDSADHAVELLRRSVREK 483
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33576842  475 GALSLSAYTTDEAVASRVQDMAEHSGVSLSLNLTGGVFVNQTAAFSDFHGTGANPAANAALSDSAFVANRFRVVQTRRHV 554
gi 28974558  480 GAMTLGVYSTDAAFLYQAESLARDVAVALSVNFDGGVFVNQSAAFSDFHATGGNPAANASITDGAFVSRRFVTVQSRRPA 559
gi 11072185  482 GALTVGLYTTKPEVVDAMTEATWRAGVALSINLTGGVFVNQSAGFSDYHGVGMNPAANASLSDSAFVANRFRVVQRRHHV 561
gi 499339552 484 GAMTVGAYTTDPEVEEAVQEVCLDEAAQLSLNLTGGVYVNQTAAFSDFHGSGGNPAANAALCDGAFVANRFRVVEVRRPA 563
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap