Conserved Protein Domain Family
TAS_TIGR02293

?
TIGR02293: TAS_TIGR02293 
putative toxin-antitoxin system antitoxin component, TIGR02293 family
Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. This family was proposed by Makarova, et al. (2009) to be the antitoxin component of a new class of type 2 toxin-antitoxin system, or addiction module. [Cellular processes, Other]
Statistics
?
PSSM-Id: 131346
View PSSM: TIGR02293
Aligned: 5 rows
Threshold Bit Score: 172.255
Threshold Setting Gi: 14027898
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10719751   15 LWREIGLPAsRGTVLVDSIKMGFSVDVIDSIH-LWASIPKAE-ILRATGIPSRSLTRRRTHDg-RFTPEESERIARFVRV 91
gi 28851492   18 FWQHLGIPA-RGTRLYTALHSGLPYEVFERLA-HYTDLNRST-LAEHLGIAPATLQRRLKVR--RFNAEESDRLFRLAAV 92
gi 33576311   33 VDSFADLVDsPLIAMAHGVQRGLSPRLLDDAA-DYLQVPKSE-IMAITEVKAASLSRWMRDGq-ALPLGESDRLARVARV 109
gi 14027898   16 GLPVKEVAArSPFGLISRIEDGLPIGALERVA-HLLAPGDAQ--FKYRLIPKATYERRKMAH--RLSSDEGTRLARVARV 90
gi 499283158  26 GSRVLAHHLtNALDAHELLLRGLPASALDHLVgNLVFIGKTEsLEKAVGMSLRTWQRRKETPnkPLSQEQSGRAWKFAEI 105
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 10719751   92 MDAAVDLFGGDkGKAITWMSTPIKGLGHRSPDS-LLETETGALEVCDLIGRLEHGVFS 148
gi 28851492   93 YKAALDLFEDDtEATRLWLANPVYGLGNRRPLE-MLATSAEAQAVLDLIGRLEHGVVA 149
gi 33576311  110 TKVARQVLGGD-AEAVQWLNTPVPALGNVKPLS-LLTSDASSRIVEDTLARAAAGVYA 165
gi 14027898   91 WGLAVDVWQNE-EEARDFLFRPHPMIEDKRPIDvVILSEFGAEIAVDILGSLKYGSAA 147
gi 499283158 106 LVKATDIFGSQ-AEAEQWLERPAVGLDQRRPID-LLGTPPGVELVEDHLDRLEYGIYA 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap