Conserved Protein Domain Family
HpaC

?
TIGR02296: HpaC 
4-hydroxyphenylacetate 3-monooxygenase, reductase component
This model identifies the reductase component (HpaC) of 4-hydroxyphenylacetate 3-monooxygenase. This enzyme catalyzes the first step (hydroxylation at the 3-position) in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. 4-hydroxyphenylacetate arises from the degradation of tyrosine. These reductases catalyze the reduction of free flavins by NADPH. The flavin is then utilized by the large subunit of the monooxygenase.
Statistics
?
PSSM-Id: 131349
View PSSM: TIGR02296
Aligned: 5 rows
Threshold Bit Score: 269.708
Threshold Setting Gi: 37198503
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12721910    9 FRNSMAKLAAGVNIITTNGIAGKCGITATAVCSVTDTPPTIMVCINKNSEMNPVFQTNKRLCVNVLSAEQLELAQHFAGF 88
gi 20454960   10 FRDAMASLSAAVNIITTEGDAGQCGITATAVCSVTDTPPSLMVCINANSAMNPVFQGNGKLCVNVLNHEQELMARHFAGM 89
gi 37198503    7 FRDAMSKLAAAVNIVTTGGEAGTVGITATAVCSVSDSPATVLVCVNRNSASNAIFKQNGNMCINVCASEHQEMSMHFAGM 86
gi 33148346   16 FRDAMAHLSAAVSIVTTNGIAGKIGLTVSSVCSVTDTPPTLLFCINKNSGVHDIIQANGKVCINVLNHQQEEMAKHFASM 95
gi 488152869  12 FRDAMASCAAGVHVITTDGAAGRYGITMTAVAPVTDEPPTVMLCINRSARIIPILSENGSLCINTLADEHQDVAEHFAGL 91
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 12721910   89 MGSCMDERFEWAVWHEKqdPVAPPSLKNALANLTGTIVDIRDIGTHSMFLVELEEIQVNEeQEHALVYFSRQFHTVG 165
gi 20454960   90 TGMAMEERFSLSCWQKG--PLAQPVLKGSLASLEGEIRDVQAIGTHLVYLVEIKNIILSA-EGHGLIYFKRRFHPVM 163
gi 37198503   87 TGLAMEERFALEGWKNN--ADQVPVLHGALATLEGKIASSQEVGTHTVFFVELHTIHSNN--KDGLIYFDREFKNVD 159
gi 33148346   96 LPSTMEERFSWDIWDEG--IDGLPILRDAISALQGDIIDTHSVGTHTIFMVQLKHIEVKP--SNSLVYFGRQFKVIT 168
gi 488152869  92 TGLSPEERFAYHIWHRG--KTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGcKRPALLYFRRQFRFLD 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap